TFome Information for pUT1134

TFome Name:pUT1134
Genbank Insert ID:HQ858678
Protein Name:ZmARR1
Species: Maize
TF Family: ARR-B
Template: DV033253
Corresponding TF Gene: GRMZM2G126834
Transcript: T02
Vector: pENTR/D-TOPO

5' Primer Name: B82 UP 3' Primer Name: B82 DN
5' Primer Sequence: CAC CAT GGC GGC GGC AAA GGC 3' Primer Sequence: CATATGTCCACTAAATCCAAatatg
5' Primer Tm (º C): 67 3' Primer Tm (º C): 50
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 sec melt, 49C 30 sec anneal, 72C 45 sec extend, 35 cycles; Step 3, 72C 7 min extend 1 cycle; Step 4, 4C hold. 1ul Phusion (New England Biolabs), GC buffer (NEB), MgCl2 1.5 mM final concentration, template 40pg/ul final concentration.
Nucleotide Sequence: ATGGCGGCGGCAAAGGCGCGGGGAGGGGAGTTCCCCGTGGGCATGAAGGTGCTGGTTGTGGACGACGACCCGACGTGCCT
CGTTGTGCTCAAGAGGATGCTCCTTGAGTGCCGATATGACGTGACAACATGTCCTCAGGCTACAAGAGCACTAACTATGT
TGCGAGAGAATAGGCGTGGTTTTGATGTTATAATAAGTGATGTCCACATGCCGGATATGGACGGATTCAGGCTACTTGAA
CTTGTAGGCCTTGAGATGGACCTTCCAGTTATCATGATGTCTGCTGATTCAAGAACGGATATTGTAATGAACGGAATTAA
GCATGGAGCATGTGACTATTTAATAAAACCTGTCAGAATGGAGGAGCTGAAAAACATCTGGCAACATGTTATTAGGAAAA
AATTTAATGAAAACAAGGACCATGAGCATTCTGGTAGCCTAGATGACACCGATCGTAACAGACCAACCAATAATGATAAT
GAATACGCTTCCTCCGCGAATGATGGAGGTGATGGCAGCTGGAAATCTCAGAGAAAGAAAAGAGAGAAAGAAGATGATGA
AACTGACCTCGAAAATGGTGATCCTTCTTCTACATCAAAGAAACCAAGAGTTGTTTGGTCAGTTGAGCTTCATCAACAAT
TTGTGAATGCAGTCAATCACCTCGGGATAGACAAAGCTGTCCCAAAGAAAATTTTGGAATTGATGAATGTCCCAGGCTTA
ACCAGGGAAAATGTTGCCAGCCATTTGCAGAAATTCAGACTCTACCTGAAGAGAATTGCTCAGCATCATGCAGGAATACC
TCATCCATTTGTTGCGCCTGTATCTAGTGCTAACGTTGCTCCGTTAGGAGGACTGGAATTCCAAGCTTTGGCTGCTTCTG
GTCAGATCCCTCCTCAAGCTCTGGCTGCTTTGCAGGATGAACTCCTTGGTCGACCTACAAGCAGTTTGGCGTTGCCTGGA
AGGGACCAGTCATCTTTGCGAGTGGCTGCAATCAAAGGAAACAAGCACCATGAAGAAAGAGAAATAGCATTTGGTCAACC
CATATACAAGTGTCAGAATAATGCATATGGTGCATTCCCTCAAAACAGCCCAGCAGTTGGAGGATTGCAACCTTTTGCAG
CTTGGCCCAATAACAAAGTTGGTATGACTGATTCAACAAGCACATTGGGAAATGTGGGCAATTCTCAAAATAGCAATATG
CTATTGCATGAATTGCAGCAACAGCCAGACACCTTGCTGTTAGGAACCCTTCACAATATTGATGCCAAACCTTCTGGTGT
AGTTATGCCATCTCAGTCGTTAAATACATTCCCGGCTAGTGAGGGTATCTCACCTAATCAAAATCCCTTGATTATACCAT
CTCAACCCCCAAGTTTTGTGTCATCAATTCCTCCATCCATGAAACATGAATCTCTTCTTGGATTACCTTCAACGTCAACC
AGTCTGTTGGGCGGGCTTGATATGGTTAATCAAGCTTCAACAAGTCAGGCTTTGATTAGTAGCCATGGAACAAATCTTCC
TGGTCTCATGAACCGTAGCTCAAATGCAATCCCTTCACCAGGAATTAGTAATTTTCAAAGTGGAAATATTCATTATGTTG
TTAATCAGAACGCTATGGGAGTTAGCTCTAAGCCACCAGGTGTTCTAAAGACCGAGAGCACTGACTCACTGAGTTGTAGT
TATGGCTATATTGGTGGTAGCACCAGTGTGGACTCTGGCTTGTTCTCTTCTCAGTCCAAAAATCCACAGTATGATCTACT
GCAGAATCAAAATGATGTTAACGGCAGCTGGTCGCCTTCACAAGATTTTGATAGTTTTGGAAATTCTCTTGGGCAAGGCC
ACCCTGGTACCACTTCATCTAACTTCCAGAGTTCCGCCCTTGGGAAGTTGCCTGACCAAGGACGAGGGAGAAATCATGGG
TTTGTCGGGAAAGGCACTTGCATTCCAAGCCGCTTTGCAGTGGATGAGGTTGAATCTCCAACTAACAACTTGAGCCACAG
CATTGGAAACAGTGGAGACATAGTGAACCCCGACATATTTGGATTTAGTGGACATATG
TFome clones do not contain stop codon at 3'end.
Translation: maaakarggefpvgmkvlvvdddptclvvlkrmllecrydvttcpqatraltmlrenrrgfdviisdvhmpdmdgfrlle
lvglemdlpvimmsadsrtdivmngikhgacdylikpvrmeelkniwqhvirkkfnenkdhehsgslddtdrnrptnndn
eyassandggdgswksqrkkrekeddetdlengdpsstskkprvvwsvelhqqfvnavnhlgidkavpkkilelmnvpgl
trenvashlqnsdst
Request Information: This plasmid is available through Addgene. It can be ordered at this URL.
PI responsible for TF ORF clone synthesis: Dr. John Gray
Biol. Sci Dept. University of Toledo, 2801 West Bancroft Street, Toledo, OH 43606
jgray5@utnet.utoledo.edu
 
Plasmid Map