TFome Information for pUT1155

TFome Name:pUT1155
Genbank Insert ID:HQ858699
Protein Name:ZmbHLH5
Species: Maize
TF Family: bHLH
Template: DR785591
Corresponding TF Gene: GRMZM2G116785
Transcript: T02
Vector: pENTR/D-TOPO
Note: c.Start+105. As present in template EST.

5' Primer Name: B34 UP 3' Primer Name: B34 DN
5' Primer Sequence: caccATGCCACCGTCAACCTAT 3' Primer Sequence: CCGTTCAGGAGGGACTGC
5' Primer Tm (º C): 59.6 3' Primer Tm (º C): 58.2
PCR Condition: Step 1, 95C 4 min melt, 1 cycle; Step 2, 95C 30 sec melt, 55C 1 min anneal, 72C 2 min extend, 35 cycles; Step 3, 72C 7 min extend 1 cycle; Step 4, 4C hold. 1ul taq DNA polymerase (Eppendorf), Taq buffer (Eppendorf), MgCl2 1.0 mM final concentration, and enhancer template 20pg/ul final concentration.
Nucleotide Sequence: ATGCCACCGTCAACCTATTTCATGACAGCTAGATCAGATCACAATTTAAATTTCAGTGTGCATGAACAGGATTCCACTAT
GCTTCCAAACGAACAGTTGACCTATGCTGGTGCTGGCCAGATTGATCTATTACCTGCTGAGACTCTATCTAGGGATAAGC
TTCCTGAAAATCTTCTGGAGCTTCAAGGACTTCAGAATATCAGCAACCTACAGAGTAATTTAGTGGCCCCAGGGGTGTTT
CAGCACAATTTAACACCTGGGGTCTTTCATCCACAGTTGAACACTCCTGGACTTTCAGAACTGCCTCATGCCTTATCTAG
TTCAATTGACAGTAATGGAAGTGAAGTTTCTGCTTTTCTCGCTGATCTAAACGCTGTTTCTTCAGCGCCAACTTTATGTT
CCACATTCCAAAACGCTTCTTCGTTCATGGAACCAGTGAATCTAGAAGCTTTCAGTATTCAAGGCGCACAAAGTGATTGT
GTTTTGAACAGAACAAGTCATCCGAATGGGAATATCTCAGTATGTGACAGTGCTGCCTTGGCATCACTACATGATAGCAA
GGAGTTTATCAGTGGTAGTCTCCCTTCTTTTGCTAGTGTCCAGGAAACAAACCTAGCTGCTAGTGGCTTCAAGACTCAGA
AGCAGGAGCAAAATGCAGTGTGCAATATCCCTACTTTCACTGCACGGAATCAAATGTCAGTTGCTGCAATGCAAGGAGCA
CTTGTCCCTCAAAAGATTCCTTCACGGATCAATGATAATAAAAGTGAGGGTCCTGTTAGCCATCCTTCTGATGTACAAAC
TCAACCAAATTCAGCTGTTAATGGTGTTGGTGTGAAACCACGAGTAAGGGCTCGTCGTGGACAAGCAACTGATCCTCATA
GTATTGCTGAACGGCTTCGCAGAGAGAAAATTTCAGATAGGATGAAAAATCTGCAGGATCTTGTCCCAAATTCCAATAAG
GCAGACAAGGCATCCATGCTGGATGAAATTATTGATTATGTGAAGTTTCTTCAGCTTCAGGTCAAGGTCTTGAGCATGAG
TAGGGTAGGAGCTCCAGGAGCAGTTCTTCCCCTTCTCACAGAATCTAAGACTGAGGGTTACCACGGCCAACCTCTGCCAC
AAGGATTACTGGACGCACTAGACTCGGAAGACAGCTTCGTCTTCGAGGAAGAGGTCGTGAAGCTAATGGAGACCAGCATC
ACCAGCGCGATGCAGTACCTTCAGAGCAAGGGGCTCTGCCTGATGCCAGTCGCCCTTGCTTCCGCAATATCCACCCAGAA
AGGTGTGTCCGCTGCTGCAGTCCCTCCTGAACGG
TFome clones do not contain stop codon at 3'end.
Translation: MPPSTYFMTARSDHNLNFSVHEQDSTMLPNEQLTYAGAGQIDLLPAETLSRDKLPENLLELQGLQNISNLQSNLVAPGVF
QHNLTPGVFHPQLNTPGLSELPHALSSSIDSNGSEVSAFLADLNAVSSAPTLCSTFQNASSFMEPVNLEAFSIQGAQSDC
VLNRTSHPNGNISVCDSAALASLHDSKEFISGSLPSFASVQETNLAASGFKTQKQEQNAVCNIPTFTARNQMSVAAMQGA
LVPQKIPSRINDNKSEGPVSHPSDVQTQPNSAVNGVGVKPRVRARRGQATDPHSIAERLRREKISDRMKNLQDLVPNSNK
ADKASMLDEIIDYVKFLQLQVKVLSMSRVGAPGAVLPLLTESKTEGYHGQPLPQGLLDALDSEDSFVFEEEVVKLMETSI
TSAMQYLQSKGLCLMPVALASAISTQKGVSAAAVPPER
Request Information: This plasmid is available through Addgene. It can be ordered at this URL.
Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Dr. John Gray
Biol. Sci Dept. University of Toledo, 2801 West Bancroft Street, Toledo, OH 43606
jgray5@utnet.utoledo.edu
 
Plasmid Map