TFome Information for pUT1164

TFome Name:pUT1164
Genbank Insert ID:HQ858708
Protein Name:ZmbZIP6
Species: Maize
TF Family: bZIP
Template: EB674186
Corresponding TF Gene: GRMZM2G039828
Transcript: T01
Vector: pENTR/D-TOPO

5' Primer Name: B62 UP 3' Primer Name: B62 DN
5' Primer Sequence: caccATGGCTGCGCAGGAGCAG 3' Primer Sequence: GCTCTTGGCGAGGTGGTGCT
5' Primer Tm (º C): 65.5 3' Primer Tm (º C): 62.8
PCR Condition: Step 1, 98C 30 sec melt, 1 cycle; Step 2, 98C 10 sec melt, 60C 30 sec anneal, 72C 45 sec extend, 35 cycles; Step 3, 72C 7 min extend 1 cycle; Step 4, 4C hold. 1ul Phusion (New England Biolabs), HF buffer (NEB), MgCl2 1.5 mM final concentration, template 40pg/ul final concentration.
Nucleotide Sequence: ATGGCTGCGCAGGAGCAGGAGCAGGAGCAGGAGAAGCAGCAGGCGAAGACGAGCACCACGAGCTCGCTCCCCTCCAGCAG
CGAGCGCTCCTCCAGCTCCGCTCGCAACAACCTCACGGAAGGAGGGGCGGAGAGCGACGAGGAGATACGGCGGGTGCCGG
AGATGGGCGGCGCGTCGGCGTCGGCCTCGTCGGGCGCCGGCGCGGACGAGCGTCCCAAGGGGGAGGACGGCAAGCAGGGG
CAGGTGGCGGCGGGGGCGCAGCCTCCGGCGGGCGGGAAGAAGCGCGGGCGCACGGCGGGGGACAAGGAGCAGAACCGGCT
GAAGCGGCTGCTGCGGAACCGCGTGTCCGCGCAGCAGGCGCGGGAGCGGAAGAAGGCGTACCTGACGGAGCTGGAGGCGA
AGGCCAAGGGCCTGGAGCTCCGCAATGCGGAGCTGGAGCAGCGGGTGTCCACGCTCCAGAACGAGAACAACACGCTCCGC
CAGATTCTGAAGAACACGACGGCGCACGCGAGCAAGAGGTCCGGCGGCGGCGGCGGCGGTGGCGGCAAGGGCGGAGACGG
CGGCAAGAAGCACCACCTCGCCAAGAGC
TFome clones do not contain stop codon at 3'end.
Translation: maaqeqeqeqekqqaktsttsslpssserssssarnnlteggaesdeeirrvpemggasasassgagaderpkgedgkqg
qvaagaqppaggkkrgrtagdkeqnrlkrllrnrvsaqqarerkkaylteleakakglelrnaeleqrvstlqnenntlr
qilknttahaskrsggggggggkggdggkkhhlaks
Request Information: This plasmid is available through Addgene. It can be ordered at this URL.
PI responsible for TF ORF clone synthesis: Dr. John Gray
Biol. Sci Dept. University of Toledo, 2801 West Bancroft Street, Toledo, OH 43606
jgray5@utnet.utoledo.edu
 
Plasmid Map