TFome Information for pUT1456

TFome Name:pUT1456
Genbank Insert ID:KJ726783
Protein Name:ZmbZIP83
Species: Maize
TF Family: bZIP
Template: EE024212
Corresponding TF Gene: GRMZM2G000171
Transcript: T02
Vector: pENTR/D-TOPO

5' Primer Name: 3' Primer Name:
5' Primer Sequence: 3' Primer Sequence:
5' Primer Tm (º C): 3' Primer Tm (º C):
PCR Condition:
Nucleotide Sequence: ATGGACGACGGGGACCTGGACTTCTCCAACCCGGACACGTACCTGTGCCCGGCGCTCGGCACTGACCCGCCCAGCAGCTG
CTCCATGGACAGCTACTTCGACGAGATCCTCAAGGACACGGAGCACCACGCCTGCACGCACACCCACACCTGCAACCCGC
CGGTGCACGACCTATCGCACACCCACACCTGCGTCCACGTCCACACCAAGATCGTCGCGGCCTCGCCCGGCGACGACACT
GCCGACTCGCCGTCCGAGAACAACACCAACGGCAGCGGCGGCAACGGCAGCAACGCCGCCTCCAAGAAGCGCCCCTCGGG
GAACCGCGCCGCCGTCAGGAAGTACCGGGAGAAGAAGAAGGCCCACACCGCGTCGCTGGAGGAGGAGGTGGTCCATCTCA
GGGCGCTCAACCAGCAGCTCGTGAAGAAGCTCCAGAGCCACGCCGCGCTCGAGGCGGAGGTGGCCAGGCTCCGATGCCTG
CTCGTCGACATCAGGGGCAGGATCGAGGGGGAGATTGGCGCGTTTCCGTACCAGAGGCCGCCGCCAGCGGCCAAGAACGT
CGACCTCGTGTCCGGTGTTGACCAGGGAGGGTTCCTTGCCGGGGCTGCTGCCCAGGTTACCAGTTCCTGTGATTTCAGAT
GCAACGATCAGATGTACTGCAGCCCTGGAATGCAGGGCGCTGTTAGCGGCCAGGTGTTGGGACAAGGTGCCTGCGATGTC
TCGAGTATCCAATGCGTTGGAAGCACCAGGTCTGCGTCCACTAAGCTACCTGTCTGCGGGGGGATGGATGCAGTACCTGC
TGCCTGCTTGCCAAATGTTCAAAACAAG
TFome clones do not contain stop codon at 3'end.
Translation: MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSHTHTCVHVHTKIVAASPGDDT
ADSPSENNTNGSGGNGSNAASKKRPSGNRAAVRKYREKKKAHTASLEEEVVHLRALNQQLVKKLQSHAALEAEVARLRCL
LVDIRGRIEGEIGAFPYQRPPPAAKNVDLVSGVDQGGFLAGAAAQVTSSCDFRCNDQMYCSPGMQGAVSGQVLGQGACDV
SSIQCVGSTRSASTKLPVCGGMDAVPAACLPNVQNK
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis:
 
Plasmid Map