TFome Information for pUT1460

TFome Name:pUT1460
Genbank Insert ID:HQ858751
Protein Name:ZmBZR1
Species: Maize
TF Family: BZR
Template: DR808352
Corresponding TF Gene: GRMZM5G812774
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: 3' Primer Name:
5' Primer Sequence: 3' Primer Sequence:
5' Primer Tm (º C): 3' Primer Tm (º C):
PCR Condition:
Nucleotide Sequence: ATGACGAGCGGCGCCGGGGGAGCCGCGGCCGGGATCGGGGGCACCAGGGTGCCCACGTGGAGGGAGCGCGAGAACAACCG
CCGCAGGGAGCGCCGGCGCCGCGCGATCGCCGCCAAGATCTTCGCCGGCCTCAGGGCCTACGGCAACTACAACCTGCCCA
AGCACTGCGACAACAACGAGGTGCTCAAGGCGCTCTGCAACGAGGCCGGCTGGACCGTCGAGCCCGACGGCACCACCTAC
CGCAAGGGATGTAAACCTCTGGCAACAGAGCGTCCAGATCCAATTGGGAGGTCTGCATCACCAAGCCCCTGCTCTTCATA
TCAACCAAGTCCGCGAGCCTCATACAACCCAAGCGCGGCATCCTCCTCGTTCCCAAGCTCTGGGTCCTCCTCCCACATTA
CTCTTGGCGGGAGCAACTTCATGGGAGGCGTCGAGGGCAGCTCCCTTATCCCGTGGCTAAAGAACCTCTCGTCGAGCTCC
TCGTTCGCCTCCTCCTCCAAGTTCCCGCAGCTTCACCACCTCTACTTCAACGGCGGTTCCATCAGCGCGCCGGTGACGCC
TCCATCCAGCTCTCCAACCCGCACGCCTCGCATCAAGACTGACTGGGAGAACCCGAGTGTTCAGCCACCGTGGGCTGGGG
CGAACTACGCGTCTCTTCCCAACTCCCAGCCGCCGAGCCCTGGGCACCAGGTTGCTCCGGACCCGGCGTGGCTAGCCGGG
TTCCAGATTTCGTCTGCTGGCCCTTCGTCTCCAACTTACAGCCTTGTGGCTCCGAATCCGTTTGGTATCTTCAAGGAGAC
CATCGTCAGCACCTCAAGAATGTGCACCCCTGGGCAGAGTGGAACGTGCTCTCCTGTAATGGGCGGTGCGCCGATCCATC
ACGATGTCCAGATGGCTGATGGTGCCCCAGATGACTTCGCCTTCGGGAGCAGCAGCAACGGCAACAACGAGTCGCCTGGT
CTCGTGAAGGCATGGGAGGGGGAACGGATACACGAGGAGTGCGCCTCGGACGAGCATGAGCTGGAGCTCACCCTTGGGAG
CTCAAAGACTCGTGCAGATCCTTCC
TFome clones do not contain stop codon at 3'end.
Translation: MTSGAGGAAAGIGGTRVPTWRERENNRRRERRRRAIAAKIFAGLRAYGNYNLPKHCDNNEVLKALCNEAGWTVEPDGTTY
RKGCKPLATERPDPIGRSASPSPCSSYQPSPRASYNPSAASSSFPSSGSSSHITLGGSNFMGGVEGSSLIPWLKNLSSSS
SFASSSKFPQLHHLYFNGGSISAPVTPPSSSPTRTPRIKTDWENPSVQPPWAGANYASLPNSQPPSPGHQVAPDPAWLAG
FQISSAGPSSPTYSLVAPNPFGIFKETIVSTSRMCTPGQSGTCSPVMGGAPIHHDVQMADGAPDDFAFGSSSNGNNESPG
LVKAWEGERIHEECASDEHELELTLGSSKTRADPS
Request Information: This plasmid is available through Addgene. It can be ordered at this URL.
Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Dr. John Gray
Biol. Sci Dept. University of Toledo, 2801 West Bancroft Street, Toledo, OH 43606
jgray5@utnet.utoledo.edu
 
Plasmid Map