TFome Information for pUT2278

TFome Name:pUT2278
Genbank Insert ID:KJ726792
Protein Name:ZmbHLH3
Species: Maize
TF Family: bHLH
Template: BT062216.1
Corresponding TF Gene: GRMZM2G180452
Transcript: T03
Vector: pENTR/SD/D-TOPO
Note: c.Start+3 c.796del55 c.Stop-14 9th exon skipped. Present in template FlcDNA, splice site supported in RNA-seq.

5' Primer Name: 3' Primer Name:
5' Primer Sequence: 3' Primer Sequence:
5' Primer Tm (º C): 3' Primer Tm (º C):
PCR Condition:
Nucleotide Sequence: ATGTATTCCCCTCCGCGCACCGATCCCGACAGAGAGGAAGAGCAGTGCTTCTCAATCGGAAGTAATCTGCTTACTTCACT
AGACCATTACCATACCATGGATTTTGATGAGCCTGTCGTCTCCCCAATGACCAATGCAGGCATGCAAGAGGGGGTTCAGC
TCTACAGTTCTACTGGAGATGCTCAACTAAATAGAAATATGAACACAGGCAAGTGTTTAGAGGATGGCAAAAGGAAGGGT
TCTGGAGAGGACAGTTCATCACTACGTTCTCTAGGTGAAACCAGTGCATTGCAGCGAGAAGTCAGCATGGAGTGTGCTGA
TGAGAAGGCGGGTGATGCTAGAGCCAAGAGAGAGGACTACGTGCATGTCCGGGCAAAGCGCGGCCAAGCCACCAACAGCC
ACAGCCTTGCAGAAAGATTTCGAAGGGAAAAGATAAATGAAAGGATGAAGCTTCTTCAAGACCTTGTCCCAGGTTGCAAC
AAGATTACAGGCAAGGCCATGATGCTTGATGAGATCATAAACTATGTGCAATCTCTGCAGCGACAGATTGAGTTCCTTTC
GATGAAGCTCTCAGCGATCGGCCCTGGGCTCAACTGTGACCTCGACCTACAAGATATCCTCTGCACACAAGATGCTAGCT
CTGCTTTTCCAGGATACAACCTGCAAACGAGCAATGTGCATATTAATCTGTACAGAGCATCTGAAGAAGGTTTCTCACAC
AGGAACAGGATCATCCCTAGTCCAGCAAATGTTCACGTGACAAGAAACGCCCAGCTATCTGCATTTCCTCAGATTCAA
TFome clones do not contain stop codon at 3'end.
Translation: MYSPPRTDPDREEEQCFSIGSNLLTSLDHYHTMDFDEPVVSPMTNAGMQEGVQLYSSTGDAQLNRNMNTGKCLEDGKRKG
SGEDSSSLRSLGETSALQREVSMECADEKAGDARAKREDYVHVRAKRGQATNSHSLAERFRREKINERMKLLQDLVPGCN
KITGKAMMLDEIINYVQSLQRQIEFLSMKLSAIGPGLNCDLDLQDILCTQDASSAFPGYNLQTSNVHINLYRASEEGFSH
RNRIIPSPANVHVTRNAQLSAFPQIQ
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map