TFome Information for pUT3027

TFome Name:pUT3027
Genbank Insert ID:KJ726800
Protein Name:ZmbHLH1
Species: Maize
TF Family: bHLH
Template: RT-PCR
Corresponding TF Gene: GRMZM5G822829
Transcript: T03
Vector: pENTR/SD/D-TOPO
Note: c.G151A p.G51R. c.C237G p.H79Q PZE10138106323 c.G285C p.(=) G336T p.(=) PZE10138106422 c.G357C p.(=) PZE10138106443 c.T372C p.(=) PZE10138106458 c.511ins15 c.632del18 c.745del3 c.C1367T p.A456V c.T1571C p.I524T Not B73 Alternate, active allele.

5' Primer Name: 3' Primer Name:
5' Primer Sequence: 3' Primer Sequence:
5' Primer Tm (º C): 3' Primer Tm (º C):
PCR Condition:
Nucleotide Sequence: ATGGCGCTTTCAGCTTCCCGAGTTCAGCAGGCGGAAGAACTGCTGCAACGACCTGCTGAGAGGCAGCTGATGAGGAGCCA
GCTTGCTGCAGCCGCCAGGAGCATCAACTGGAGCTACGCCCTCTTCTGGTCCATTTCAGACACTCAACCAAGGGTGCTGA
CGTGGACGGACGGGTTCTACAACGGCGAGGTGAAGACGCGGAAGATCTCCAACTCCGTGGAGCTGACATCCGACCAGCTC
GTCATGCAGAGGAGCGACCAGCTCCGGGAGCTCTACGAGGCCCTCCTGTCGGGCGAGGGCGACCGCCGCGCTGCGCCTGC
GCGGCCGGCCGGCTCTCTGTCGCCGGAGGACCTCGGCGACACCGAGTGGTACTACGTGGTCTCCATGACCTACGCCTTCC
GGCCAGGCCAAGGGTTGCCCGGCAGGAGTTTCGCGAGCGACGAGCATGTCTGGCTGTGCAACGCGCACCTCGCCGGCAGC
AAAGCCTTCCCCCGCGCGCTCCTGGCCAAGAGCGCGTCCATTCAGTCAATCCTCTGCATCCCGGTTATGGGCGGCGTGCT
TGAGCTTGGTACAACTGACACGGTGCCGGAGGCCCCGGACTTGGTCAGCCGAGCAACCGCGGCTTTCTGGGAGCCGCAGT
GCCCGAGCTCCAGCCCGTCAGGACGAGCAAACGAGACCGGCGAGGCCGCAGCAGACGACGGCACGTTTGCGTTCGAGGAA
CTCGACCACAATAATGGCATGGACGACATAGAGGCGATGACCGCCGCCGGGGGACACGGGCAGGAGGAGGAGCTAAGACT
AAGAGAAGCCGAGGCCCTGTCAGACGACGCAAGCCTGGAGCACATCACCAAGGAGATCGAGGAGTTCTACAGCCTCTGCG
ACGAAATGGACCTGCAGGCGCTACCACTACCGCTAGAGGACGGCTGGACCGTGGACGCGTCCAATTTCGAGGTCCCCTGC
TCTTCCCCGCAGCCAGCGCCGCCTCCGGTGGACAGGGCTACCGCTAACGTCGCCGCCGACGCCTCAAGGGCACCCGTCTA
CGGCTCTCGCGCGACGAGTTTCATGGCTTGGACGAGGTCCTCGCAGCAGTCGTCGTGCTCCGACGACGCGGCGCCCGCAG
CAGTAGTGCCGGCCATCGAGGAGCCGCAGAGATTGCTGAAGAAAGTGGTGGCCGGCGGCGGTGCTTGGGAGAGCTGTGGC
GGCGCGACGGGAGCAGCACAGGAAATGAGTGGCACTGGCACCAAGAACCACGTCATGTCGGAGCGAAAGCGACGAGAGAA
GCTCAACGAGATGTTCCTCGTCCTCAAGTCACTGCTTCCGTCCATTCACAGGGTGAACAAAGCGTCGATCCTCGCCGAAA
CGATAGTCTACCTCAAGGAGCTTCAGAGAAGGGTGCAAGAGCTGGAGTCCAGTAGGGAACCTGCGTCGCGCCCATCCGAA
ACGACGACAAGGCTAATAACAAGGCCCTCCCGTGGCAATAATGAGAGTGTGAGGAAGGAGGTCTGCGCGGGCTCCAAGAG
GAAGAGCCCAGAGCTCGGCAGAGACGACGTGGAGCGCCCCCCGGTCCTCACCATGGACGCCGGCACCAGCAACGTCACCG
TCACCGTCTCGGACAAGGACGTGCTCCTGGAGGTGCAGTGCCGGTGGGAGGAGCTCCTGATGACGCGAGTGTTCGACGCC
ATCAAGAGCCTCCATTTGGACGTCCTCTCGGTTCAGGCTTCAGCGCCAGATGGCTTCATGGGGCTTAAGATACGAGCTCA
GTTTGCTGGCTCCGGTGCCGTCGTGCCCTGGATGATCAGCGAGGCTCTTCGCAAAGCTATAGGGAAGCGG
TFome clones do not contain stop codon at 3'end.
Translation: MALSASRVQQAEELLQRPAERQLMRSQLAAAARSINWSYALFWSISDTQPRVLTWTDGFYNGEVKTRKISNSVELTSDQL
VMQRSDQLRELYEALLSGEGDRRAAPARPAGSLSPEDLGDTEWYYVVSMTYAFRPGQGLPGRSFASDEHVWLCNAHLAGS
KAFPRALLAKSASIQSILCIPVMGGVLELGTTDTVPEAPDLVSRATAAFWEPQCPSSSPSGRANETGEAAADDGTFAFEE
LDHNNGMDDIEAMTAAGGHGQEEELRLREAEALSDDASLEHITKEIEEFYSLCDEMDLQALPLPLEDGWTVDASNFEVPC
SSPQPAPPPVDRATANVAADASRAPVYGSRATSFMAWTRSSQQSSCSDDAAPAAVVPAIEEPQRLLKKVVAGGGAWESCG
GATGAAQEMSGTGTKNHVMSERKRREKLNEMFLVLKSLLPSIHRVNKASILAETIVYLKELQRRVQELESSREPASRPSE
TTTRLITRPSRGNNESVRKEVCAGSKRKSPELGRDDVERPPVLTMDAGTSNVTVTVSDKDVLLEVQCRWEELLMTRVFDA
IKSLHLDVLSVQASAPDGFMGLKIRAQFAGSGAVVPWMISEALRKAIGKR
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis:
 
Plasmid Map