TFome Information for pUT3050

TFome Name:pUT3050
Genbank Insert ID:KJ726803
Protein Name:ZmCA3P1
Species: Maize
TF Family: CCAAT-HAP3
Template: E177028
Corresponding TF Gene: GRMZM2G303465
Transcript: T04
Vector: pENTR/SD/D-TOPO

5' Primer Name: 3' Primer Name:
5' Primer Sequence: 3' Primer Sequence:
5' Primer Tm (º C): 3' Primer Tm (º C):
PCR Condition:
Nucleotide Sequence: ATGGCCGACGACGGCGGGAGCCACGAGGGCAGCGGCGGCGGCGGAGGCGTCCGGGAGCAGGACCGGTTCCTGCCCATCGC
CAACATCAGCCGGATCATGAAGAAGGCCGTCCCGGCCAACGGCAAGATCGCCAAGGACGCTAAGGAGACCCTGCAGGAGT
GCGTCTCCGAGTTCATATCATTCGTGACCAGCGAGGCCAGCGACAAATGCCAGAAGGAGAAACGAAAGACAATCAACGGG
GACGATTTGCTCTGGGCGATGGCCACTTTAGGATTCGAGGAGTACGTCGAGCCTCTCAAGATTTACCTACAAAAGTACAA
AGAGATGGAGGGTGATAGCAAGCTGTCTACAAAGGCTGGCGAGGGCTCTGTAAAGAAGGATGCAATTAGTCCCCATGGTG
GCACCAGTAGCTCAAGTAATCAGTTGGTTCAGCATGGAGTCTACAACCAAGGGATGGGCTATATGCAGCCACAGTACCAC
AATGGGGAAACC
TFome clones do not contain stop codon at 3'end.
Translation: MADDGGSHEGSGGGGGVREQDRFLPIANISRIMKKAVPANGKIAKDAKETLQECVSEFISFVTSEASDKCQKEKRKTING
DDLLWAMATLGFEEYVEPLKIYLQKYKEMEGDSKLSTKAGEGSVKKDAISPHGGTSSSSNQLVQHGVYNQGMGYMQPQYH
NGET
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis:
 
Plasmid Map