TFome Information for pUT3104

TFome Name:pUT3104
Genbank Insert ID:JX428506
Protein Name:ZmARF4
Species: Maize
TF Family: ARF
Template: BT066632
Corresponding TF Gene: GRMZM2G034840
Transcript: T02
Vector: pENTR/SD/D-TOPO
Note: c.C418T p.P140S; Not in functional domain. c.T905C p.M302T; PZE0203329045 In functional domain. c.A1569T p.(=) Present in Template FlcDNA.

5' Primer Name: UT-2750up 3' Primer Name: UT-2750dn
5' Primer Sequence: caccATGATGACGTCCTCGTACGAGAAGGC 3' Primer Sequence: AGCCATTTGCATGCAGTCGTTCAAGA
5' Primer Tm (º C): 62.4 3' Primer Tm (º C): 64.4
PCR Condition: Step 1, 98°C 30 sec melt, 1 cycle; Step 2, 98°C 10 sec melt, 62°C 30 sec anneal, 72°C 45 sec extend, 35 cycles; Step 3, 72°C 7 min extend 1 cycle; 1ul Phusion (New England Biolabs), 1XGC buffer (NEB), 3.5 mM MgCl2, 10% Glycerol, 40pg/ul template.
Nucleotide Sequence: ATGATGACGTCCTCGTACGAGAAGGCCACGTCGGGTGTCCTGAGGAACGCGGCGGCGCTGCTCGACGAAATGCAGCTCAT
GGGAGAAACGCAGGGTGCCAAGAAGGTGATCAACTCCGAGCTGTGGCACGCGTGCGCGGGGCCGCTGGTCTGCTTGCCGC
AGCGGGGGAGCCTCGTCTACTACTTCCCCCAGGGGCACAGCGAGCAGGTTGCTGCTACCACTAAAAAGATACCCAACTCT
CGCATCCCAAACTACCCGAGTCTCCCGTCGCAGCTGCTATGTCAAGTCCACAACATCACTTTGCATGCTGACAAAGAAAC
TGATGAGATTTATGCCCAGATGACCCTGCAACCAGTACACTCGGAAACTGATGTGTTCCCAATCCCAACGCTCGGTGCTT
ATACCAAAAGCAAGCACTCCAGTGAATATTTCTGCAAGAATTTGACTGCAAGTGATACAAGTACGCATGGTGGTTTCTCG
GTGCCACGGAGAGCTGCAGAGAAGCTGTTTCCGCAGTTGGATTATTCAATGCAGCCTCCTAATCAGGAGCTTATCGTTCG
AGATCTGCATGATAACATGTGGACATTCCGTCACATTTATCGTGGCCAGCCAAAGCGACATCTTCTAACAACTGGATGGA
GTCTTTTTGTTGGTGCGAAACGGCTTAAAGCTGGTGACTCTGTCTTATTTATCAGGGATGAGAAGTCACAGCTCCTTGTG
GGTGTTAGGCGGGCCACCAGACAACAACCGGCTTTGTCATCATCCGTCCTGTCTACTGACAGTATGCACATTGGTGTTCT
TGCTGCTGCAGCTCATGCAGCATCAAGTGGTGGCTCGTTTACTGTTTACTACAATCCTCGGACAAGCCCGTCGCCATTTG
TGATTCCTCTCGCAAGGTACAATACGGCCACATATCTGCAACCATCAGTTGGAATGAGATTCGCGATGATGTTTGAGACG
GAGGAGTCAAGCAAGCGCAGATGCACAGGTACAATTGTGGGAATTAGCGACTATGAACCGATGCGATGGCCAAACTCAAA
ATGGCGCAACTTGCAGGTAGAATGGGATGAACATGGGTATGGAGAAAGACCTGAAAGAGTTAGTCTATGGGATATCGAAA
CTCCAGAGAACATGGTTTTCTCTTCCCCATTGAATTCGAAAAGGCAATGTCTTCCTAGTTATGGAGTTTCTGGCCTACAT
GTGTCATCAATTTCAAAGCCACAAGGAAGTCCTTTTGGTAACTTGCAGCACATGCCAGGGATCAGTTCAGACATTGCTTT
GCTGCTTCTCAATCAATCTGCCCAGAACCTCGGGAGTTCAATTGCTTGTCAACAATCATCATTTTCCAGCATTATTCAAA
ATGCTAAGCAAAGCTATTTCCCTCCAACGACATTAGGTGCTTCCACTGGTTGGAATGAATCTCAGCAGCAGTTAAACGCC
CTTGGTATTCAAAAAGGTGATCAAGTAAGCTGTGATGTTCAGCCAGGTATTGATTCAATCACTGCACCGGAGATGAATGT
TAAACCAAGAGTCCCAAGAAGCACGGATTCATACTCAAGTCAGAGCATATCGGATCCAAACAGCAAGAGTGACCCTAAAA
CAAAAACGCGAAGGAGCAAGAAGAGCTCGTCTCACAAAACCATTTCGGATAAATCTGAGATTTCTTCAGTACCTTCTCAG
ATCTGTGACAAGCAAAGGCATGGTTCAGAACCAACATCGGCAGACTTTGAAGCAGAACAAGCTACCTGTGGGAACAATGA
GGATTCATCTGGTGCACTCACACGTGGTGATTTTGCTGGAGAGCTACAAGTTCAGCAGGTTGAACAAGATGGTCTACTTC
CACCACCGAAGTTAGAGTCATCAAAGTCACCTGATGGAGGGAAGTCCGTCAGCTCGTTCCCAAACCAAGGGTGTTTCTCA
CAGTTCTTTGAGGGTCTGGATTGGATGATCCCGCCTTCCTGCTACCAAGACTCCAATGGCATCCATTCAGTTACCACATC
GGATAGCATCTTTAATCCGTCTGAAGGTATACCACCTTCCACAATGAACGCGGACGGCATGGACGCGTTCCAAACCTCTT
GCCTTTCCGAGTGCTTTCCTAATTCCATCCAAGAATTCATCAGCAGTCCAGATATAAACACACTGACATTTATGTCGCCT
GAGATGCAACATCTGGATGCCCAACACGACGGCAGCAACTTGCAGAGCACGTCCAACTCCTATGTGCAGATGAGCTTCTC
GGAGGAGAGCCAGAGTGCATCCTTAAGTGGCCTACACATGGAAGCTGTCCATATCAACAGCTCCTGCCTTCAACCACTGG
CGACAGGGAGCTTTGATGCAGGGACGTTCTCAAAACTATCAAACATAAAAGAATGCCAGGCCTTGCCTCTGCAGGAGATT
CACAACAGCTCCATGGGAACACCTTCGTGCAGTATGGATGCGGCGGCGGTCGAGTACTGTATGGATCGAAGTGTGAAGCC
ACTGAAACCACCGGTCCGGACATATACAAAGGTTCAAAAGTTAGGATCAGTTGGAAGATCTATCGACGTTACACGGTTTA
GAGACTACCATGAGTTGAGGTCAGCCATTGCCTGCATGTTTGGACTACAGGGGAAACTGGAACACCCTGGCAGTTCAGAC
TGGAAGCTTGTTTATGTCGACTACGAGAACGATGTTCTCCTCGTTGGAGACGACCCGTGGGAGGAGTTCATCAACTGTGT
GAGATGCATTCGGATCCTGGCGCCTTCGGAAGTACAGCAGATGAGCGAGAATGGCGTGCATGTCTTGAACGACTGCATGC
AAATGGCT
TFome clones do not contain stop codon at 3'end.
Translation: MMTSSYEKATSGVLRNAAALLDEMQLMGETQGAKKVINSELWHACAGPLVCLPQRGSLVYYFPQGHSEQVAATTKKIPNS
RIPNYPSLPSQLLCQVHNITLHADKETDEIYAQMTLQPVHSETDVFPIPTLGAYTKSKHSSEYFCKNLTASDTSTHGGFS
VPRRAAEKLFPQLDYSMQPPNQELIVRDLHDNMWTFRHIYRGQPKRHLLTTGWSLFVGAKRLKAGDSVLFIRDEKSQLLV
GVRRATRQQPALSSSVLSTDSMHIGVLAAAAHAASSGGSFTVYYNPRTSPSPFVIPLARYNTATYLQPSVGMRFAMMFET
EESSKRRCTGTIVGISDYEPMRWPNSKWRNLQVEWDEHGYGERPERVSLWDIETPENMVFSSPLNSKRQCLPSYGVSGLH
VSSISKPQGSPFGNLQHMPGISSDIALLLLNQSAQNLGSSIACQQSSFSSIIQNAKQSYFPPTTLGASTGWNESQQQLNA
LGIQKGDQVSCDVQPGIDSITAPEMNVKPRVPRSTDSYSSQSISDPNSKSDPKTKTRRSKKSSSHKTISDKSEISSVPSQ
ICDKQRHGSEPTSADFEAEQATCGNNEDSSGALTRGDFAGELQVQQVEQDGLLPPPKLESSKSPDGGKSVSSFPNQGCFS
QFFEGLDWMIPPSCYQDSNGIHSVTTSDSIFNPSEGIPPSTMNADGMDAFQTSCLSECFPNSIQEFISSPDINTLTFMSP
EMQHLDAQHDGSNLQSTSNSYVQMSFSEESQSASLSGLHMEAVHINSSCLQPLATGSFDAGTFSKLSNIKECQALPLQEI
HNSSMGTPSCSMDAAAVEYCMDRSVKPLKPPVRTYTKVQKLGSVGRSIDVTRFRDYHELRSAIACMFGLQGKLEHPGSSD
WKLVYVDYENDVLLVGDDPWEEFINCVRCIRILAPSEVQQMSENGVHVLNDCMQMA
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map