TFome Information for pUT3198

TFome Name:pUT3198
Genbank Insert ID:JX469939
Protein Name:ZmbZIP40
Species: Maize
TF Family: bZIP
Template: BT062069.1
Corresponding TF Gene: AC203957.3_FG004
Transcript: T004
Vector: pENTR/SD/D-TOPO

5' Primer Name: B524_F 3' Primer Name: B524_R
5' Primer Sequence: caccATGTCAAGTGGAAGCTCGTTTGG 3' Primer Sequence: ATAATAGCACCGGTACGCGTCTATGG
5' Primer Tm (º C): 68.3 3' Primer Tm (º C): 66.7
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l primer reverse 20mM 5 l glycerol 50% 1 l DNA template (c=1 ng/l) 1 l MgCl2 50mM 1 l dNTPs 10mM 0.25 l phusion taq (NEB M0530L, now replaced by F-530) 10.75 l ultrapure water PCR program: 40 sec 98°C 30x : 15 sec 98°C 30 sec 58°C 30 sec 72°C 7 min 72°C leave at 4°C
Nucleotide Sequence: ATGTCAAGTGGAAGCTCGTTTGGGTCGAGCCAGTGGACTCAGAGATCCAGGTCGGCGGAGGATGACCTGGACCTGGACCT
CCAGGCCGAGATGGAGAAGAGGAGGAAACGAAGGAAGGAGTCCAACCGAGAGTCGGCTCGGAGGTCTAGGCTAAGGAAGC
AGCAACACCACGACGACCTCACGTCACAGGTAGACCAGCTGAAGGGCCAGAACAAGCAGCTCAACTTGGCGCTGAGCACG
ACCAGCCAAAACCTCGTGGCAGTGCAAGCGCAGAACTCTGTCCTGCAGACCCAGAGGATGGAGCTGGCCAGCAGGCTGGG
CGCCCTGACCGAGATCCTCTGGTGCATCAGCTCAAGCACCGGCACTGCTGCTCCTCCTACAAACCCAGCCATGGTGAACG
GCGGCGTCACGACGACATGGAGCTGGAGCGACGCCTCTGGTGATATTCTTGGCGCCAGCGCATGGAACCACCAGCAGCAG
CAGCCCATAGACGCGTACCGGTGCTATTAT
TFome clones do not contain stop codon at 3'end.
Translation: MSSGSSFGSSQWTQRSRSAEDDLDLDLQAEMEKRRKRRKESNRESARRSRLRKQQHHDDLTSQVDQLKGQNKQLNLALST
TSQNLVAVQAQNSVLQTQRMELASRLGALTEILWCISSSTGTAAPPTNPAMVNGGVTTTWSWSDASGDILGASAWNHQQQ
QPIDAYRCYY
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map