TFome Information for pUT3351

TFome Name:pUT3351
Genbank Insert ID:JX469991
Protein Name:ZmABI1
Species: Maize
TF Family: ABI3-VP1
Template: BT060994
Corresponding TF Gene: GRMZM2G133398
Transcript: T02
Vector: pENTR/SD/D-TOPO

5' Primer Name: UT-2785up 3' Primer Name: UT-2785dn
5' Primer Sequence: caccATGGAAGCCTCCGCCGGCTCGTC 3' Primer Sequence: GATGCTCACCGCCATCTGGCTCATG
5' Primer Tm (º C): 69.9 3' Primer Tm (º C): 63
PCR Condition: Step 1, 98°C 30 sec melt, 1 cycle; Step 2, 98°C 10 sec melt, 63C 30 sec anneal, 72°C 20 sec extend, 35 cycles; Step 3, 72°C 7 min extend 1 cycle; 1ul Phusion (New England Biolabs), GC buffer (NEB), MgCl2 3.5 mM final concentration, 10% Glycerol, template 40pg/ul final concentration.
Nucleotide Sequence: ATGGAAGCCTCCGCCGGCTCGTCGCCACCGCACTCCCAAGAGAACCCGCCGGAGCACGGTGGCGACATGGGAGGGGCCCC
CGCGGAGGAGATCGGAGGGGAGGCGGCGGATGATTTCATGTTCGCTGAAGACACGTTCCCCTCCCTCCCGGACTTCCCTT
GCCTTTCGTCGCCGTCCAGCTCCACCTTCTCGTCCAACTCCTCGTCAAACTCCTCCAGCGCCTACACCAACACGGCAGGA
AGAGCCGGCGGCGAGCCCTCCGAGCCTGCTTCGGCCGGAGAAGGGTTTGATGCGCTCGATGACATCGACCAGCTCCTCGA
CTTCGCGTCGCTTTCCATGCCGTGGGACTCCGAGCCGTTCCCGGGGGTTAGCATGATGCTAGAGAACGCCATGTCGGCGC
CGCCGCAGCCGGTGGGCGACGGCATGAGTGAAGAGAAAGCCGTGCCGGAAGGGACCACAGGGGGAGAGGAGGCCTGCATG
GATGCGTCGGAGGGGGAGGAGCTGCCGCGGTTCTTCATGGAGTGGCTCACGAGCAACCGCGAAAACATCTCGGCCGAGGA
TCTCCGCGGGATCCGCCTCCGCCGCTCCACCATCGAGGCCGCCGCCGCCCGGCTCGGCGGCGGGCGCCAGGGCACCATGC
AGCTGCTCAAGCTCATCCTCACCTGGGTGCAGAACCACCACCTCCAGAGGAAGCGCCCGCGCGACGTGATGGAGGAGGAG
GCGGGCCTGCACGTCCAGCTCCCCAGCCCGGTCGCCAACCCACCAGGATACGAGTTCCCCGCCGGCGGACAGGACATGGC
CGCGGGCGGCGGCACATCTTGGATGCCCCACCAGCAGGCATTCACGCCGCCTGCTGCGTACGGCGGCGACGCGGTGTACC
CGAGCGCGGCAGGCCAACAGTACTCTTTCCACCAGGGCCCCAGCACGAGCAGCGTGGTCGTGAACAGCCAACCGTTCTCC
CCGCCGCCTGTGGGCGACATGCACGGCGCGAACATGGCCTGGCCGCAGCAGTACGTGCCGTTCCCACCGCCTGGGGCTTC
CACGGGCTCTTACCCTATGCCGCAGCCGTTCTCCCCCGGATTCGGCGGGCAGTACGCCGGCGCCGGCGCTGGCCACCTCT
CAGTGGCCCCCCAGCGCATGGCAGGCGTGGAGGCCTCGGCGACCAAGGAGGCCCGCAAGAAGCGCATGGCGAGACAGCGG
CGCCTGTCCTGCCTGCAGCAGCAGCGCAGCCAGCAGCTGAGCCTGGGCCAGATCCAGGCCTCCGTCCACCTGCAGGAGCC
GTCCCCTCGGTCCACGCACTCCGGCCCGGTCACGCCGTCAGCAGGCGGCTGGGGATTCTGGTCGCCGAGCAGCCAGCAGC
AGGTCCAGAACCCGCTCTCCAAGTCCAATTCATCAAGGGCGCCGCCTCCCTCGCTGGAAGCGGCGGCGGTGGCGCCACAG
ACAAAGCCCGCGCCTGCTGGTGCTCGGCAGGACGACATTCACCACCGCCTCGCAGCGGCTTCAGATAAGCGGCAGGGCGC
CAAGGCGGACAAGAACCTGCGGTTCCTGCTGCAGAAGGTGCTGAAGCAGAGCGACGTCGGGAGCCTCGGCCGCATCGTGC
TCCCCAAAGAAGCGGAGGTTCACCTGCCGGAGCTGAAGACGAGGGATGGCATCTCCATCCCCATGGAGGACATCGGAACG
TCGCGCGTGTGGAACATGCGGTACAGGTTTTGGCCCAACAACAAGAGCAGAATGTATCTGCTGGAGAACACAGGGGAATT
TGTTCGTTCCAACGAGCTTCAGGAGGGGGATTTCATAGTGATCTACTCCGATGTCAAGTCGGGCAAATATCTGATACGGG
GCGTGAAGGTAAGGCCCCCGCCGGCGCAAGAGCAAGGCAGTGGTTCCAGCGGGGGAGGCAAGCACAGGCCCCTCTGTCCA
GCAGGTCCAGGGAGAGCCGCAGCCGCCGGTGCTCCTGAAGACGCCGTCGTCGACGGGGTCAGCGGCGCCTGCAAGGGGAG
GTCTCCGGAAGGCGTGCGGCGGGTTCGGCAGCAGGGAGCCGGCGCCATGAGCCAGATGGCGGTGAGCATC
TFome clones do not contain stop codon at 3'end.
Translation: MEASAGSSPPHSQENPPEHGGDMGGAPAEEIGGEAADDFMFAEDTFPSLPDFPCLSSPSSSTFSSNSSSNSSSAYTNTAG
RAGGEPSEPASAGEGFDALDDIDQLLDFASLSMPWDSEPFPGVSMMLENAMSAPPQPVGDGMSEEKAVPEGTTGGEEACM
DASEGEELPRFFMEWLTSNRENISAEDLRGIRLRRSTIEAAAARLGGGRQGTMQLLKLILTWVQNHHLQRKRPRDVMEEE
AGLHVQLPSPVANPPGYEFPAGGQDMAAGGGTSWMPHQQAFTPPAAYGGDAVYPSAAGQQYSFHQGPSTSSVVVNSQPFS
PPPVGDMHGANMAWPQQYVPFPPPGASTGSYPMPQPFSPGFGGQYAGAGAGHLSVAPQRMAGVEASATKEARKKRMARQR
RLSCLQQQRSQQLSLGQIQASVHLQEPSPRSTHSGPVTPSAGGWGFWSPSSQQQVQNPLSKSNSSRAPPPSLEAAAVAPQ
TKPAPAGARQDDIHHRLAAASDKRQGAKADKNLRFLLQKVLKQSDVGSLGRIVLPKEAEVHLPELKTRDGISIPMEDIGT
SRVWNMRYRFWPNNKSRMYLLENTGEFVRSNELQEGDFIVIYSDVKSGKYLIRGVKVRPPPAQEQGSGSSGGGKHRPLCP
AGPGRAAAAGAPEDAVVDGVSGACKGRSPEGVRRVRQQGAGAMSQMAVSI
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map