TFome Information for pUT3355

TFome Name:pUT3355
Genbank Insert ID:KJ726816
Protein Name:ZmARF18
Species: Maize
TF Family: ARF
Template: BT088318
Corresponding TF Gene: GRMZM2G035405
Transcript: T02
Vector: pENTR/SD/D-TOPO

5' Primer Name: C478F 3' Primer Name: C478R
5' Primer Sequence: caccATGTGGCTTCGAGATACCGC 3' Primer Sequence: TCCCAACTCGACCGAACCGA
5' Primer Tm (º C): 67.9 3' Primer Tm (º C): 60.7
PCR Condition:
Nucleotide Sequence: ATGGCAAAAGATCTTCATGGCAATGAGTGGAAATTCCGTCACATCTTTCGTGGCCAGCCAAAGCGGCATCTTCTAACTAC
AGGTTGGAGTGTCTTTGTAAGTGCAAAGAGACTCGTTGCTGGCGACTCTGTCCTTTTTATCTGGAATGACAATAACCAGC
TTCTGCTGGGAATTCGTCGTGCAAATCGGCCACAAACTGTCATGCCATCTTCAGTCTTATCAAGCGATAGCATGCATATC
GGTCTTCTTGCTGCAGCTGCTCATGCTGCTTCGACAAATAGCCGATTTACAATTTTTTACAACCCAAGGGCAAGCCCTTC
AGAGTTTGTCATACCACTCGTAAAGTATGTTAAGGCTGTGTATCATACCCGCATATCTGTGGGGATGCGATTCAGGATGC
TTTTTGAGACAGAAGAGTCTAGCGTTAGGAGATACATGGGGACAATTACCGGAATCTGTGATCTTGATTCTGTTCGGTGG
CCAAATTCACACTGGCGTTCTGTTAAGGTTGGCTGGGATGAGTCAACTGCTGGTGAGCGACAACCAAGGGTGTCACTATG
GGAGATTGAACCCCTGACAACTTTCCCAATGTATCCATCTCCTTTTCCGCTCAGGCTCAAGCGTCCATGGCCAACAGGCT
TGCCTTCTCTGCATGGTGGGAAGGATGATGACCTGGCTAACTCTCTCATGTGGCTTCGAGATACCGCAAATCCTGGTTTT
CAGTCGTTAAATTTTGGTGGACTTGGTATGAGCCCTTGGATGCAGCCAAGGCTGGATGCTACCTTACTTGGTCTGCAACC
TGACATGTATCAGGCGATGGCCACAGCTGCTTTTCAGGATGCAACAAAGCAGGCATCGCCCACAATGCTGCAGTTCCAGC
AGCCCCAGAACATAGCTGGCCGGGCTTCCCCGCTTCTTTCAAGTCAGATTTTGCAGCAAGCACATCATCAATTTCAGCAG
CAACCGTACCTTCAAAACATCTCTGAGAGCACAATCCAAGCACAGGGTCAGTCTGAGTTCCTCAAGCAGCAGATCCAACG
CAGCCAGTCATTCAATGAGCAGAAGCCCCAGATGCAACACCAGCAAGAATCACAGCAGCAGCAGCAACCACAGTGTCTGC
CAGTCCCCCAACATCAGCAAATGCAACAACAGAATATGACCAACTACCAGTCTATATCTAATGCATTATCACCGTTTTCT
CAGCTGTCGCCAGTTTCTCAGTCTTCACCTATGGCGCTGCAGACTATATTACCGTTCTCGCAGGCACAGAGCTTCACAGA
CACGAATGTAGGTTCATTGTCTCCATCCAATGGTAACACCATGCAAAACACACTGAGGCCGTTCTCATCAGAAGCAGTTT
CTCACCTCAGTATGCCGAGGCCCACTGCGATACCTGTCGCAGACCCATGGTCGTCGAAGCGTGTCGCGGTGGAGTCTCTG
CTTCCTTCTCGGCCTCAGGTTTCATCCCAGATGGAACAATTGGACCCTGCACCAGCTAGTATACCTCATAGCTCTGCGTT
GGCACCACTTCCCGGAAGAGGGTGCTTGGTTGACCAAGATGTGAACTCTGATCCTCAAAATCATCTCTTGTTCGGTGTTA
GTATAGACTCGCAGTCACTGCTAATGCAAGGGGGCATTCCTGGTCTCCAAAACGGGAATGATTCAGCTGCTATACCTTAT
TCCACTTCCAATTTCCTCAGCCCTTCTCAGAATGACTTTCCTCTGGACCATACACTAAATTCTTCAGGCTGCTTAGATGA
TTCTGGGTACGTCCCGCCATGTTCAGATAATTCTGACAAAGTGAACCGACCACCAGCGACCTTCGTGAAGGTTTACAAAT
CTGGAACCTACGGGAGGTCGCTTGATATCACTAGGTTTAGCAGCTATCACGAGCTCCGTAGGGAACTGGGGCGCCTATTT
GGCCTTGAGGGCCAGTTGGAAGACCCATTGAGATCAGGCTGGCAGCTTGTATTCGTCGACCGTGAGGAGGACGTCCTTCT
CGTGGGCGACGACCCTTGGCAGGAATTCGTGAGCACGGTGTCCTGCATAAAGATCCTCTCCCCGCAGGAGGTGCAGCAGA
TGGGGAAGCAGGGCCTGGAGCTCCTGAGCTCGGCCCCCGCGCGGAGGCTCGGTAGCAGCTGTGACGACTACGTCAGCAGG
CAGGAGTCGAGAAGCCTGAGCACCGGGATCGCGTCCGTCGGTTCGGTCGAGTTGGGA
TFome clones do not contain stop codon at 3'end.
Translation: MAKDLHGNEWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQTVMPSSVLSSDSMHI
GLLAAAAHAASTNSRFTIFYNPRASPSEFVIPLVKYVKAVYHTRISVGMRFRMLFETEESSVRRYMGTITGICDLDSVRW
PNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTTFPMYPSPFPLRLKRPWPTGLPSLHGGKDDDLANSLMWLRDTANPGF
QSLNFGGLGMSPWMQPRLDATLLGLQPDMYQAMATAAFQDATKQASPTMLQFQQPQNIAGRASPLLSSQILQQAHHQFQQ
QPYLQNISESTIQAQGQSEFLKQQIQRSQSFNEQKPQMQHQQESQQQQQPQCLPVPQHQQMQQQNMTNYQSISNALSPFS
QLSPVSQSSPMALQTILPFSQAQSFTDTNVGSLSPSNGNTMQNTLRPFSSEAVSHLSMPRPTAIPVADPWSSKRVAVESL
LPSRPQVSSQMEQLDPAPASIPHSSALAPLPGRGCLVDQDVNSDPQNHLLFGVSIDSQSLLMQGGIPGLQNGNDSAAIPY
STSNFLSPSQNDFPLDHTLNSSGCLDDSGYVPPCSDNSDKVNRPPATFVKVYKSGTYGRSLDITRFSSYHELRRELGRLF
GLEGQLEDPLRSGWQLVFVDREEDVLLVGDDPWQEFVSTVSCIKILSPQEVQQMGKQGLELLSSAPARRLGSSCDDYVSR
QESRSLSTGIASVGSVELG
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map