TFome Information for pUT3400

TFome Name:pUT3400
Genbank Insert ID:KJ726859
Protein Name:ZmbHLH27
Species: Maize
TF Family: bHLH
Template: BT035348
Corresponding TF Gene: GRMZM2G092091
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: UT3260up 3' Primer Name: UT3260dn
5' Primer Sequence: caccATGTACTCAGGCCAGCAATCTGATCAA 3' Primer Sequence: CTGTTCGATCTTCATGGAGCCAGAG
5' Primer Tm (º C): 63.1 3' Primer Tm (º C): 59.1
PCR Condition:
Nucleotide Sequence: ATGTACTCAGGCCAGCAATCTGATCAAGGTCCTAGTGCAAATAGTGGCAGAGAATTCTCCGAGGCAAATTGGAATTCTTA
CACAATGCATCAAAAGATAGCTTATAGTGGACAACATGGGTTTGGACCTTACGGCATGGGCTTAGAAGATAGGCTGGGGT
TGTATCAATCTTCATCTGGTACATTAAGTCATGACATCCAAATGAGTGATGAGCATAGCGGAGGTGTGAAGAAGAGGAAA
GGAGTGGAGGACTGTGTCACATTGTTGCCTAATGCAGGTGATCAACAAACAGAAGGTTCATCTCAGCCAGAAAGGAATTC
AATGGAGGAGGGGAACAGAAAGATTTCGCCCAAAATACAAAGCAAGGAAGATTCTTCTGATGGTGATGGTACTAAAGAGG
ACTATGTTCATATCCGGGCAAAGCGAGGTCAAGCCACTAACAGCCACAGCCTCGCAGAAAGACTGAGGAGAAAAAAGATA
AGTGAGAGAATGAAGCTTCTTCAAGATCTTGTTCCTGGATGCAGTAAGATCACTGGCAAGGCAGTCATGCTCGATGAGAT
TATCAACTATGTACAGTCATTGCAACGACAAGTGGAGTTCTTGTCAATGAAACTTTCAACTGTTAACCCTGAACTTGGCT
TTGACATTGAGCAGATCATATCCAAACAAATGATGCTTTCACAAGACAGACATCTTGCTTTCTATGGAGTCGATCCAGGA
TCAAGCAGCCTTACTGCTCCATTCAACCAAGGAATCGTGCAGCCAGCAATGATGTGCAACATTTCTAATCCTGCCGATGT
TTTGCACGGAACTATTCATGACGTGTCAACAATGAACCAGATACCTTCCATGTGGGAAGGACTTCAGAGCATGCCTCAGA
TGAACTTCAACCCTGGTGTGGCAGCTGATAGCGGCACCAACAACTCTGGCTCCATGAAGATCGAACAG
TFome clones do not contain stop codon at 3'end.
Translation: MYSGQQSDQGPSANSGREFSEANWNSYTMHQKIAYSGQHGFGPYGMGLEDRLGLYQSSSGTLSHDIQMSDEHSGGVKKRK
GVEDCVTLLPNAGDQQTEGSSQPERNSMEEGNRKISPKIQSKEDSSDGDGTKEDYVHIRAKRGQATNSHSLAERLRRKKI
SERMKLLQDLVPGCSKITGKAVMLDEIINYVQSLQRQVEFLSMKLSTVNPELGFDIEQIISKQMMLSQDRHLAFYGVDPG
SSSLTAPFNQGIVQPAMMCNISNPADVLHGTIHDVSTMNQIPSMWEGLQSMPQMNFNPGVAADSGTNNSGSMKIEQ
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map