TFome Information for pUT3427

TFome Name:pUT3427
Genbank Insert ID:KJ726886
Protein Name:ZmbHLH56
Species: Maize
TF Family: bHLH
Template: EC889590
Corresponding TF Gene: GRMZM2G072376
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: UT3310up 3' Primer Name: UT3310dn
5' Primer Sequence: caccATGGGTGGTCACGGCGACC 3' Primer Sequence: CTCGATCCGCGCGTGTGTAAT
5' Primer Tm (º C): 66.6 3' Primer Tm (º C): 59.9
PCR Condition: Step 1, 98°C 30 sec melt, 1 cycle; Step 2, 98°C 10 sec melt, 60.0°C 30 sec anneal, 72°C 20 sec extend, 35 cycles; Step 3, 72°C 7 min extend 1 cycle; 1ul Phusion (New England Biolabs),1XGC buffer (NEB), 3.5 mM MgCl2,10% Glycerol,40pg/ul template.
Nucleotide Sequence: ATGGGTGGTCACGGCGACCACCACCGCCGCCGCCGCCAGGAAGTCGAAGTGCTCGTCCACGACGACGACGAGGATCTCGA
GCACCAGTCCAGGGCCTGCGGTGGCGGTGCCACTAGCGGAGTAGTGGTGGAGCAAGGAGCAGGAGATGGCGGCGGTCAGG
CGGCGAGCAGTAGCCTGGGAAGCGTGAGTGCAGCGACCATGGCGCCGCCGCAGATCTTCTGCTGGCCGCCACAGCACCAC
CACAACAGCAGCAACGACGTCGGCGGAGGCCAGCAGCCCCCGTTCTTCCCGCCTCTGCCGCCGCTCCCCCCGACACCGCC
GCCCTTCTTCGCCGACTTGTACGCGCGGCGCGCGCTCCAGCTCGCGTACGATCACCACCATCCAGGCGGCGGCCCGTCCA
CGTCGTCGGACCCACTCGGCCTCTACATGGCGGGCGGCGGCTCCGGGATGATGATGATGCCCCCGCCCTTCGCGTCGTCG
TTGCCGTTCGGGGACTTTGGCCGGATGACCGCGCAGGAGATCATGGACGCCAAGGCGCTGGCCGCGTCCAGGAGCCACAG
CGAGGCCGAGCGCAGGCGCCGCGAGCGCATCAACGCGCACCTCGCGCGCCTCCGCAGCCTCCTGCCCAACACAACCAAGG
TACTAATACTAATAATAATCGACGACATTACACACGCGCGGATCGAG
TFome clones do not contain stop codon at 3'end.
Translation: MGGHGDHHRRRRQEVEVLVHDDDEDLEHQSRACGGGATSGVVVEQGAGDGGGQAASSSLGSVSAATMAPPQIFCWPPQHH
HNSSNDVGGGQQPPFFPPLPPLPPTPPPFFADLYARRALQLAYDHHHPGGGPSTSSDPLGLYMAGGGSGMMMMPPPFASS
LPFGDFGRMTAQEIMDAKALAASRSHSEAERRRRERINAHLARLRSLLPNTTKVLILIIIDDITHARIE
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map