TFome Information for pUT3656

TFome Name:pUT3656
Genbank Insert ID:KJ726958
Protein Name:ZmCA5P15
Species: Maize
TF Family: CCAAT-HAP5
Template: EB408976
Corresponding TF Gene: GRMZM2G099461
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: UT-2898up 3' Primer Name: UT-2898dn
5' Primer Sequence: caccATGTCCCCCGCCACCGC 3' Primer Sequence: GGTAACCTTCTGGAAGAAGGCATCG
5' Primer Tm (º C): 59.3 3' Primer Tm (º C): 59.3
PCR Condition:
Nucleotide Sequence: ATGTCCCCCGCCACCGCCGACGAACCCAGCGTCGCAATGGAGGAGCAGCCCGGAAAGGAGAGCGAGGAAGCCGCCGATGC
AATGGAAGAGCAGCTCGGAAAGGAGAGCGAGGAGGCGGCAGAGTCCGCCGAGGAAGTGGGGCAAGTCGAGGAGGAGCCCG
AGGAGGGCGTCGACCCCGCCGAGGCAATGGAGAAGGCTGGAGAGGAGGCGGAGGCCGAAGAGGGGGCGTCGCTGCGGCCG
GCGCTGCCGGTGGGGAGGGTCAAGCGGATCATGCGGGTGGACCGGGACATCAAGAAGGTGACGAGCGAGGCGGCGCTGCT
CATCGCCGCCGCCACCGAGCTCTTCCTGGGCAGCCTCGCGACAGGGGCCCACGCCGCGGCGGCGCGGCGCAGCCGGCGCA
CTGTGCGTGCCGTGCACGTCCGCGCCGCGGCCCGCGCGCACCGGCCCACGGCGGACTTCCTGCTTGACTGCCTCGCTGCC
GAAGAGGAGGCTCCCCGCGCCCGCCAGACCGCAGGATCAGCCCGCGGCGGCGGCGGCGGAGGAGGAGGGAACGCGAAGCC
GCTGCCGCGTGGGACCCGCCGCATCGATGCCTTCTTCCAGAAGGTTACC
TFome clones do not contain stop codon at 3'end.
Translation: MSPATADEPSVAMEEQPGKESEEAADAMEEQLGKESEEAAESAEEVGQVEEEPEEGVDPAEAMEKAGEEAEAEEGASLRP
ALPVGRVKRIMRVDRDIKKVTSEAALLIAAATELFLGSLATGAHAAAARRSRRTVRAVHVRAAARAHRPTADFLLDCLAA
EEEAPRARQTAGSARGGGGGGGGNAKPLPRGTRRIDAFFQKVT
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map