TFome Information for pUT3690

TFome Name:pUT3690
Genbank Insert ID:KJ726989
Protein Name:ZmbHLH114
Species: Maize
TF Family: bHLH
Template: BT039004
Corresponding TF Gene: GRMZM2G095899
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.C65T p.P22L Not in functional domain, present in template FlcDNA.

5' Primer Name: UT3297up 3' Primer Name: UT3297dn
5' Primer Sequence: caccATGGAGGACTCGAGCCAGTTCATGC 3' Primer Sequence: ACACGTTGGTCCAGCTGCTAGCACT
5' Primer Tm (º C): 62.6 3' Primer Tm (º C): 64.3
PCR Condition:
Nucleotide Sequence: ATGGAGGACTCGAGCCAGTTCATGCAGTGGGCCCTGAGCACGCTGCAGCACGATGAGCTCCCACTGGCGACGCCGCCGGC
GGCCATCGCCTACGACGACAATGACTGCAACACCTTCTCATCAGTCCCGGCGCTGGGGTACTCCGCTGCATCAGTCAACA
GCATGGTCCCGGCGGAACCACCAGCACAGGAAGGCCACCGGGCCACCGCCGCCACCAACAGCTGGAGCTCGGCCGACACC
GCGTCCGTCACGGCCGCGCAGCGTGACGCCTGGTCGCCGTCTTCGCAGCAGAACTCGGTCAATTGTGCCACGCCCCGCAG
CAGCGGCAGCAGCCAGCCCGTGAGCTGGGACTTCCATTCGGCGTCGGCGTCGGCGTCGGCGCAGCTAATAATCAAAGAAG
CCCAGGTCAACTCTGCCACGGCCGCAAGGGCAGAGAGCGCCGCTGGCGGCATGCCGGTGCCACAGCCACAGATGGTTCAA
AACGGGTCGCCGCCGACGAGGAGGGCCTCTGCCAAAATGTCGTCGGCTTCTTCGTCTGCGCCGCCGTGCTCCCAGGATCA
CATCGTCGCGGAGCGGAAACGCCGGGAGAAGATCAACCAGCGTTTCATTGAGCTCTCGGCAGTCATCCCCTGCCTCAAGA
AGATGGACAAGGCGACTATCCTATCCGACGCGACGAGGTACGTGAAGGAGCTCCAAGAAAAGCTCAAGGCACTGCAACAA
GGCGGAAGCTGCAACGCCCGGGGCGGCACGGAGTCGGCGCCGGTGCTTGTCAAGAAGCCGCGCATAGCGGCGCCGGGGGA
TGACGACAAGGACCGCGGCGGCGCGCCTTCCCCTTCCTGCGCGCCGCCTGGGGCTGCGGCGACCACCGGGAACGCGCTGC
CGGAGATCGAGGCGAGGATCTCGGACGGCAACGTCGTGATGCTGAGGATCCACTGCGAGGACGGCAAGGGGGTGCTCGTC
AGGCTGCTGGCCGAGGTCGAGGGACTCCGCCTCAGCATCACGCATACCAATGTCATGCCCTTCTCGGCCTGCATCCTCAT
CATAAACATAATGGCAAAGGTGGCGGAGGGCTTCAACGCCACGGCGGATGGCATTGTAGGGAGGCTTAATGCAGTGCTAG
CAGCTGGACCAACGTGT
TFome clones do not contain stop codon at 3'end.
Translation: MEDSSQFMQWALSTLQHDELPLATPPAAIAYDDNDCNTFSSVPALGYSAASVNSMVPAEPPAQEGHRATAATNSWSSADT
ASVTAAQRDAWSPSSQQNSVNCATPRSSGSSQPVSWDFHSASASASAQLIIKEAQVNSATAARAESAAGGMPVPQPQMVQ
NGSPPTRRASAKMSSASSSAPPCSQDHIVAERKRREKINQRFIELSAVIPCLKKMDKATILSDATRYVKELQEKLKALQQ
GGSCNARGGTESAPVLVKKPRIAAPGDDDKDRGGAPSPSCAPPGAAATTGNALPEIEARISDGNVVMLRIHCEDGKGVLV
RLLAEVEGLRLSITHTNVMPFSACILIINIMAKVAEGFNATADGIVGRLNAVLAAGPTC
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map