TFome Information for pUT3962

TFome Name:pUT3962
Genbank Insert ID:KJ726990
Protein Name:ZmbHLH135
Species: Maize
TF Family: bHLH
Template: gDNA
Corresponding TF Gene: GRMZM2G134735
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: Tup7 3' Primer Name: Tdn7
5' Primer Sequence: caccATGGACTTGGACATGCTGAATTCTC 3' Primer Sequence: CCACTGGCCGTTGATGCG
5' Primer Tm (º C): 57.4 3' Primer Tm (º C): 58
PCR Condition: Step 1, 98°C 30 sec melt, 1 cycle; Step 2, 98°C 10 sec melt, 57.4°C 35 sec anneal, 72°C 45 sec extend, 35 cycles; Step 3, 72°C 7 min extend 1 cycle; 1ul Phusion (New England Biolabs), GC buffer (NEB), MgCl2 3.5 mM final concentration, 10% Glycerol, template 4ng/ul final concentration
Nucleotide Sequence: ATGGACTTGGACATGCTGAATTCTCACCCGGAGGCGCAGCTGGAGCTGATGAACGCAATGCTCCAGCTGGAGCAGCTCGC
CGGGTTCCCTCTCCATGACCACGGCGGGGCCATAATGATGGCGGTGCCTTCGACTCCCCCGTCGCCGCCGCCGCCGCCGG
GCATGCAGCAGCAAGCAGCTACTCACCACCACCATCTCTCTTCGGTGCCTCGTCACATGTCCGCGGGCGCCACCGCCAAC
AACAACGGCCGTGCCGGCGTGTACGACGACCACCAGTACCCCCGGCAGGTCAGAGTCACAGCCGCGTCGTCGTCGTCGTG
CTCGTGCAACGACGGCGGCAGCAGCGGAGAGATCAGCGCCACCGCCGCTGCCGCCGTCGGGTCATCGTCGTCGTCGTCGG
CGATGCGGGAGATGGTCTTCCGCGTGGCGGCGCTGCAGCCGGTGAACATCGAGCCGGAGATGGTGCGGCCCCCGAAGCGG
CGCAACGCGCGCATCTCCACCGACCCGCAGAGCGTGGCGGCGCGGGTGCGGCGGGAGCGCATCAGCGAGCGCATCCGCGT
CCTGCAGCGCCTCGTCCCGGGCGGCACCAAGATGGACACCGCGTCCATGCTGGACGAGGCCATCCACTACGTCAAGTTCC
TCAAGACGCAGGTGCAGTCCCTCGAGCGCGCCGCCGCGGCCGACGCCCGCCGCCCGGTACCAGACAACGGTGGCGCCGCG
CCCTACTCATCCGCCCGCATCAACGGCCAGTGG
TFome clones do not contain stop codon at 3'end.
Translation: MDLDMLNSHPEAQLELMNAMLQLEQLAGFPLHDHGGAIMMAVPSTPPSPPPPPGMQQQAATHHHHLSSVPRHMSAGATAN
NNGRAGVYDDHQYPRQVRVTAASSSSCSCNDGGSSGEISATAAAAVGSSSSSSAMREMVFRVAALQPVNIEPEMVRPPKR
RNARISTDPQSVAARVRRERISERIRVLQRLVPGGTKMDTASMLDEAIHYVKFLKTQVQSLERAAAADARRPVPDNGGAA
PYSSARINGQW
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map