TFome Information for pUT3965

TFome Name:pUT3965
Genbank Insert ID:KJ726993
Protein Name:ZmCA5P17
Species: Maize
TF Family: CCAAT-HAP5
Template: gDNA
Corresponding TF Gene: GRMZM2G052499
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: Tup31 3' Primer Name: Tdn31
5' Primer Sequence: caccATGGATCGTCCTATTAATATCCG 3' Primer Sequence: GCCATGCCTTACATCGTTAC
5' Primer Tm (º C): 51 3' Primer Tm (º C): 50
PCR Condition: Step 1, 98°C 30 sec melt, 1 cycle; Step 2, 98°C 10 sec melt, 50.7°C 35 sec anneal, 72°C 45 sec extend, 35 cycles; Step 3, 72°C 7 min extend 1 cycle; 1ul Phusion (New England Biolabs), GC buffer (NEB), MgCl2 3.5 mM final concentration, 10% Glycerol, gDNA template 4ng/ul final concentration
Nucleotide Sequence: ATGGATCGTCCTATTAATATCCGTACATCACCAAGGACGCCCTTGTCGTTGTCCGAGCAACAAACGATAAAAGAATTTTG
GAGGAAGAAACAAGAAGAAATTGAGGCAATTGAGGACTTTGGAGAGCACACAATCCCCGTGACCTGTCTCAAAAAGGTTA
TTTGTGCTAAGAAGGGTAAAATGATGATGACGTCTGACACCCCAACATTCATGACAAAGGCATGTAAGATATTTGTGCAG
GAACTTTCACTCAGTGCTTGGATGTGTGCCAATTCACACAACCGTAGCATCGTACTGGATTCTGATATTGCTGAGTCAAT
TGCCTCCATTGAGTCATATGGTTTTCTAAATGATGTTCTATGCGCACATCTTGAAAAGTACAAGTCTGATACACATCTAC
AATCTATAAAAAATCCTCATCACAATAGGGCTATAAATCAGTCACCAACATATCTCCAACCTCTTTCTCATCAATACCAA
ATGACACAATTTATTCCTCAGTCTACTAGATATTGTCCCTTTATTCACATTCCTCCAACTTTACCACAAACTAATGATAT
TCACATGCATCTACCCTTGCCACTCCCACCTATCACATACATGACCAAGGATCTTGTGTTCTTTGAAAAAGGCATTAGCA
ACAATGATGATGCTATAGATCTTGTGACTCCTCCACAATTACTTCCAGAAGCACTGTCCAATATTCCAAATAAGTGTTAC
ATGTGTAACATTGCTTCTACTGATACATATTGTGTTGGTAGTGCTAAGACTTGTAATTTTATTGCTGAAGATGGAGACAT
GGTGTTCCATTTTCCATATGTTCCTTCAAAGCCTTTCCAATTATCAACCTCATTACCAATGACTAATGGCGGTTGTTCTA
TATATACTGATATCACCGAGCTGAATCATATCAAATTAAAGGTAACACATATCGAAAAATCTACATATGGCATTAATCCT
GAAGCTACTTTCAATGTTATTGATGGTCAACAACATGCGGGAGATGAAACCACTGCTGCCAATCATATGCATACTGAACA
TGGAGAGTTAGATGCAGAATTTGTTACTACTACTAATGCTAATGCAGATGACAACAATATAAATTGGGACGAAGTTGACA
TGGCAAGTGATTCCATGTTGATGGAGTTTTGGAGAGATGTAATGATGAAAGAAGACCCAACATCTTTACCTGACACTATC
TCTACCAATGATACTATTTTAGATCCTAGTGATATGTTAGAACTTGAGGGGTGCTGTGATGATTCTTATCTTCTTGATGA
TGTCATGTCTAACACAAGTAACGATGTAAGGCATGGC
TFome clones do not contain stop codon at 3'end.
Translation: MDRPINIRTSPRTPLSLSEQQTIKEFWRKKQEEIEAIEDFGEHTIPVTCLKKVICAKKGKMMMTSDTPTFMTKACKIFVQ
ELSLSAWMCANSHNRSIVLDSDIAESIASIESYGFLNDVLCAHLEKYKSDTHLQSIKNPHHNRAINQSPTYLQPLSHQYQ
MTQFIPQSTRYCPFIHIPPTLPQTNDIHMHLPLPLPPITYMTKDLVFFEKGISNNDDAIDLVTPPQLLPEALSNIPNKCY
MCNIASTDTYCVGSAKTCNFIAEDGDMVFHFPYVPSKPFQLSTSLPMTNGGCSIYTDITELNHIKLKVTHIEKSTYGINP
EATFNVIDGQQHAGDETTAANHMHTEHGELDAEFVTTTNANADDNNINWDEVDMASDSMLMEFWRDVMMKEDPTSLPDTI
STNDTILDPSDMLELEGCCDDSYLLDDVMSNTSNDVRHG
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map