TFome Information for pUT3991

TFome Name:pUT3991
Genbank Insert ID:KJ727010
Protein Name:ZmCA5P2
Species: Maize
TF Family: CCAAT-HAP5
Template: gDNA
Corresponding TF Gene: GRMZM2G479610
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: Tup27 3' Primer Name: Tdn27
5' Primer Sequence: caccATGAGGCAGGCGAGGCCGTACTC 3' Primer Sequence: GAGCGCGCCGTCACCGTC
5' Primer Tm (º C): 64.3 3' Primer Tm (º C): 62.2
PCR Condition: Step 1, 98°C 30 sec melt, 1 cycle; Step 2, 98°C 10 sec melt, 67.7°C 30 sec anneal, 72°C 12 sec extend, 35 cycles; Step 3, 72°C 5 min extend 1 cycle; 5ng/ul gDNA template, 1x GC (NEB), 3.5mM MgCl2, 0.2mMdNTP, 0.5uM ea primer, 7.5%glycerol, 3%DMSO, 0.02U/ul Phusion (NEB); 5ng/ul gDNA template
Nucleotide Sequence: ATGAGGCAGGCGAGGCCGTACTCGGGGATCTTCTGCGGCGGGGTGTCGGCGCGGACGGGCCCGCACGCGCTGCCGCTGGC
GCGCATCAAGAAGATCATGAAGCGCTCCGCGGGGGAGGCGGCGGCCGCCGCGGACGGCGGCGCCAGGATGATCTCCTGCG
AGGCGCCCGTTGTGTTCTCCAAGGCGTGCGAGCTCTTCGTCGCCGAGCTCACGCGCCGCGCCTGGGCCGCCACGCTCGAC
GGCAAGCGCCGCACCGTGCACAGGGAGGACGTCGCCACGGCCGTGCACAACACCGACCTCTTCGACTTCCTCGTCGACGT
CGTCACGGCGGACACTGCAGGTGGAACCGGCGGCGGCGGGCACGACGGCGACGGTGACGGCGCGCTC
TFome clones do not contain stop codon at 3'end.
Translation: MRQARPYSGIFCGGVSARTGPHALPLARIKKIMKRSAGEAAAAADGGARMISCEAPVVFSKACELFVAELTRRAWAATLD
GKRRTVHREDVATAVHNTDLFDFLVDVVTADTAGGTGGGGHDGDGDGAL
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map