TFome Information for pUT3993

TFome Name:pUT3993
Genbank Insert ID:KJ727012
Protein Name:ZmbHLH109
Species: Maize
TF Family: bHLH
Template: gDNA
Corresponding TF Gene: GRMZM2G013688
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: Tup5 3' Primer Name: Tdn5
5' Primer Sequence: caccATGGACGACCTGCTCTCCCCGTG 3' Primer Sequence: GCTGTCCTGCATCATCTGGAGCAGC
5' Primer Tm (º C): 65 3' Primer Tm (º C): 65
PCR Condition: Step1: 98°C 30s melt, 1 cycle; Step2: 98°C 10sec melt, 66.8°C 30sec anneal, 72°C 17sec extend, 35 cycles; Step3: 72°C 5 min extend, 1 cycle; Step4: 4°C ; 5ng/ul gDNA template, 1x GC (NEB), 3.5mM MgCl2, 0.2mMdNTP, 0.5uM ea primer, 7.5%glycerol, 3%DMSO, 0.02U/ul Phusion (NEB), 5ng/ul gDNA template
Nucleotide Sequence: ATGGACGACCTGCTCTCCCCGTGCTCGTCCTTCTCCCCGCCGTCGCCGCCGTCCTTCTTCTCCCACGCCGTCCACCCAGT
CATCGAGTTCGCCTCCTGTGAGGTCCCCGAGCAATGGCTACTCGACGACCTCGTCGTCGCCAAGAACGAGGGCTATGACG
ACGTGGACGACCTATGGCCCGTGCGGAGCTCGCTCTCCCCGGACTCCGAGGTCTCCGAGCAGCCGCTTCCTCCCCAGCCG
CCGCCGCCGTCACAGCAGGAGCTGACGAGCGTCAGGGCGGCCCCGGCGCAGCAGCAGCAGCGCCTCGGGAAGCGGCGTGG
GCGGAAACCAGGGCCCCGCCCGGACGGCCCCGCCGTCAGCCACGTGGAGTCCGAGCGGCAGCGGCGGGAGAAGCTGAACC
GGCGGTTCTGCGACCTCCGCGCTGCCGTGCCCACCGTGTCGCGCATGGACAAGGCGTCCCTGCTCGCGGACGCCGCCTCC
TACATCGCGGAGCTCCGCGGCCGCGTCGCGCGGCTCGAGGCCGACTCCAGGCGTGCCGCCGCGTCGAGGTGGGACCCTGC
CGTAGCGGCGGCGGCCTCCGCCAGCACCGCCACTATAGGGCTGGCGGGAGCCGGCGGCGGCGCCGACGAGGCGGTGGAGG
TGCGGATGCTGGGGCCGGACGCGGCCGCGGTACGCGCGACGAGCGCGGGCCCCCACGCGCCCGCGCGGCTGATGGGCGCG
CTCCGGTCTCTGGAGCTCCACGTGCAGCACGCCTGCGTGACCCGCGTGAACGGCGTGACCGTTCTGGACGTCGTGGTCGA
CGTGGCGACTCCGCTGCAGGACGACGACGGCGGACTCCGCGCCACGCTGCTCCAGATGATGCAGGACAGC
TFome clones do not contain stop codon at 3'end.
Translation: MDDLLSPCSSFSPPSPPSFFSHAVHPVIEFASCEVPEQWLLDDLVVAKNEGYDDVDDLWPVRSSLSPDSEVSEQPLPPQP
PPPSQQELTSVRAAPAQQQQRLGKRRGRKPGPRPDGPAVSHVESERQRREKLNRRFCDLRAAVPTVSRMDKASLLADAAS
YIAELRGRVARLEADSRRAAASRWDPAVAAAASASTATIGLAGAGGGADEAVEVRMLGPDAAAVRATSAGPHAPARLMGA
LRSLELHVQHACVTRVNGVTVLDVVVDVATPLQDDDGGLRATLLQMMQDS
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map