TFome Information for pUT4951

TFome Name:pUT4951
Genbank Insert ID:KJ727394
Protein Name:ZmARID3
Species: Maize
TF Family: ARID
Template: Synthesized with codon optimization for maize
Corresponding TF Gene: GRMZM2G110109
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: 3' Primer Name:
5' Primer Sequence: 3' Primer Sequence:
5' Primer Tm (º C): 3' Primer Tm (º C):
PCR Condition:
Nucleotide Sequence: ATGAGCGACCCAAGAGGTCATGCTGCTGGTCCAGATAGAGATGGCGACGATCCACTTGCTGAGGACGCTAACTCTGAGGA
AGCTTGGCAGACCCCAGAGAAGGAACCAGTGGCTGTGTCTAAGGAAGCTGCTGCTAGAGGCGGTGATACCACTCCAGATG
CTGAGCCAGAGTCTGATGATGGCGAAGGCGGTGTTGGCTCTCCAGATCAGATGGAACCTAATGCTGACGGCGAGAGGGCT
CCACCAGTTGCAGCTGCTGAAGATCCAGAGGGCATCGTGGGTTCTGCTAAGGTTGAGACTAACGGCGAGGATGCCATCAG
CCTGGATGCTGATGGGGAAGAGGAAGATGACGACGACGATGGTGACGAGGAGGAAGAAGAAGAGGATGACGATGATGACG
ACAGCACCCCAGATGCTTCTCCAAGGGCTGAGGTTAAGGTGGAAGGCGAATCTTCTACCGGCATGACTCAATCTGGCGCT
GGCCATAGAGTTGAGGTCGAGCCAGATCCATTCTTGGACGGTGATGATAGCGGCACCGAAGAGGAGCAAGGCGCTTTCAT
GGCTGAGCTTGAAAGATTCCACCGCGAGCACAGCCTCGAGTTCAAGCCACCAAAGTTCTACGGCAAGGGCCTGAACTGCC
TTAAGCTTTGGAGGCAAGTGGCTCATCTGGGCGGCCATGAACAAGTGACTGTCTGTAAGCTGTGGCGCCAGGTTGGCGAG
ACTTTTAGACCGCCAAAGACCTGCACCACCGTGAGCTGGTCTTTCAGGATTTTCTACGAGAAGGCCCTGCTCGAGTACGA
AAAGCACAAGGTTAGGACTGGCCAGCTGCAGATCCCACCACCAGGACTTCCACAACCATCTGGTGCTGACAGGGAAGTGG
TGGTGAACCAGAGTAGCTCTGCTAGGGTTAGAAGGGATGCTGCCGCTAGGGCTATGCAAGGTTGGCATGCTCATAGGCTG
CTGACCAATGGCACCTACGGCGACAACATCCTGAAGGACAAGGACACCATGCCGCTGCCAAACAGGGACAAGAATCTGTC
TTTCGGCGTGCTGAAGCGCAAGAAGGCATCTTCTCCAGAGTACGCCCTTAAGAGCAGCAGGTCCAAGACCAACAAGAGCC
AAGAGGACAGCATGGTGGTTGATGTGGGTGAGCCAGCTGACTGGGTGAAGATCAACGTGAGGCAGACCAAGGACTGCTTC
GAGGTGTACGCTTTGGTGCCAGGCCTTTTGAGAGAAGAGGTGCACGTTCAGTCTGACCCAGCTGGCAGGCTTGTTATCAC
TGGCGATCCTGAGCAGCCAGATAACCCATGGGGCATCACCCCATTCAAGAAGGTGGTCAACCTGCCGTCTAGGATCGACC
CACACCAAACCTCTGCTGTGGTGACTCTGCATGGCCAACTGTTTGTTAGAGCCCCATTCGGCCACCCAGACATG
TFome clones do not contain stop codon at 3'end.
Translation: MSDPRGHAAGPDRDGDDPLAEDANSEEAWQTPEKEPVAVSKEAAARGGDTTPDAEPESDDGEGGVGSPDQMEPNADGERA
PPVAAAEDPEGIVGSAKVETNGEDAISLDADGEEEDDDDDGDEEEEEEDDDDDDSTPDASPRAEVKVEGESSTGMTQSGA
GHRVEVEPDPFLDGDDSGTEEEQGAFMAELERFHREHSLEFKPPKFYGKGLNCLKLWRQVAHLGGHEQVTVCKLWRQVGE
TFRPPKTCTTVSWSFRIFYEKALLEYEKHKVRTGQLQIPPPGLPQPSGADREVVVNQSSSARVRRDAAARAMQGWHAHRL
LTNGTYGDNILKDKDTMPLPNRDKNLSFGVLKRKKASSPEYALKSSRSKTNKSQEDSMVVDVGEPADWVKINVRQTKDCF
EVYALVPGLLREEVHVQSDPAGRLVITGDPEQPDNPWGITPFKKVVNLPSRIDPHQTSAVVTLHGQLFVRAPFGHPDM
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: This construct was synthesized by Life Technologies Corporation using codon optimization for maize.
 
Plasmid Map