TFome Information for pUT5352

TFome Name:pUT5352
Genbank Insert ID:KJ727493
Protein Name:ZmbZIP123
Species: Maize
TF Family: bZIP
Template: BT033269.1
Corresponding TF Gene: GRMZM2G002075
Transcript: T01
Vector: pENTR/D-TOPO
Note: c.G571A p.E191K not present in template FlcDNA. (not in functional domain)

5' Primer Name: B446_F 3' Primer Name: B446_R
5' Primer Sequence: caccATGGACGAGCTGCTCCG 3' Primer Sequence: CCAGGGGGCCGTCAACG
5' Primer Tm (º C): 75 3' Primer Tm (º C): 73
PCR Condition: 40 sec 98°C 30x : 15 sec 98°C 30 sec 58°C 40 sec 72°C 7 min 72°C leave at 10°C
Nucleotide Sequence: ATGGACGAGCTGCTCCGGAGCATCTGGACCGCAGAGGAGACCCAGGCCAAGGCCTCCGCCTCTATCGCAGGAGCGAGCGC
GGGGATGCCCCCCACGCCGATGCAGCGGCAGGGATCGTCGCTCACACTGCCCCGCATGCTCAGCACCAAGACGGTCGACG
AGGCGTGGAGAAATCTCGTGCGCGACGAACCGCCGCAGGGGGCGGACGGCGGCGGACACCAGCCGCCCCACCGCCAGTCA
ACGCTCGGGGAGATGACTCTGGAGGAGTTCTTGGTCAGAGCTGGCGCGGTCAAGGAGAACCCCGCTTCTGCTCCTCCAGC
GCCGCCACCCATGGTGCCGCCGCGGCCGGTACCTGTTGCCCCTAAAAGCTCCGCCTTTTTTGGGGATTTACCGGGTGCCG
ACGACGACGCAGCTACGGCAGCGGTAGGGTTTGCACCGGTCGGCATGGTGGATCTGGCCCTGATACCGCCCAGGGCGGCA
GGCATGGGAGGCAGCGCCATGGCTGTGCAAACAGCGGTGAGCCAGCTTGATTCTGTCGGGAAGGGATACAGCGACCTGTC
GTCGCTGACGAAGCCGCAAACTTTTTCGTTTGAAAGAATGATTCGGGGGAGAAGGCATGGAGGCGGAGTGGAGAAAGTGG
TGGAGAGGCGGCGGCGGAGGATGATCAAGAACAGGGAGTCCGCCGCGAGGTCCCGAGCGCGCAAACAGGCTTATACAATG
GAGTTAGAAGCCGAAGTTCAGAAACTCAGAGAGCAGAATCAGGAACTGGAGAGGAAACAGGCAGAAATTATGGAAATGCA
GAACAACGAGGTATCAGAAATGTTGAAGGATCCATTCGGACGGAAGAAACGGCTGTGCTTGCGAAGAACGTTGACGGCCC
CCTGG
TFome clones do not contain stop codon at 3'end.
Translation: MDELLRSIWTAEETQAKASASIAGASAGMPPTPMQRQGSSLTLPRMLSTKTVDEAWRNLVRDEPPQGADGGGHQPPHRQS
TLGEMTLEEFLVRAGAVKENPASAPPAPPPMVPPRPVPVAPKSSAFFGDLPGADDDAATAAVGFAPVGMVDLALIPPRAA
GMGGSAMAVQTAVSQLDSVGKGYSDLSSLTKPQTFSFERMIRGRRHGGGVEKVVERRRRRMIKNRESAARSRARKQAYTM
ELEAEVQKLREQNQELERKQAEIMEMQNNEVSEMLKDPFGRKKRLCLRRTLTAPW
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map