TFome Information for pUT5417

TFome Name:pUT5417
Genbank Insert ID:KJ727557
Protein Name:ZmbZIP117
Species: Maize
TF Family: bZIP
Template: BT061266.1
Corresponding TF Gene: AC233853.1_FG002
Transcript: T002
Vector: pENTR/SD/D-TOPO

5' Primer Name: B487_F 3' Primer Name: B487_R
5' Primer Sequence: caccATGGCGCAGCTGCCGCCCAAGA 3' Primer Sequence: CGAGGGCGGGCCGGGCG
5' Primer Tm (º C): 71.1 3' Primer Tm (º C): 71.4
PCR Condition: PCR Reaction Mix: 5 l GC buffer 5l glycerol 50% 1 l primer forward 20mM 1 l primer reverse 20mM 1 l DNA template (c=1 ng/l) 1l MgCl2 50mM 1 l dNTPs 10mM 0.25 l phusion taq (FL-530) 9.75 l ultrapure water PCR program: 40 sec 98°C 30x : 15 sec 98°C 30 sec 60°C 40 sec 72°C 7 min 72°C leave at 4°C
Nucleotide Sequence: ATGGCGCAGCTGCCGCCCAAGATCCCCACCGTGGCGCCGGCGTGGCCGGAGTTCGGGGGCGGGCACCAGCAGCAGCGCAG
CCCCTCCGTGGGCACGTTCCTCGCCGCCGCGCCCATGCAGCCGTCGTGGGTGGACGAGTTCCTCGACTTCTCCGCCGCCA
AGCGCGGCGCGCACCGCCGCTCCGTCAGCGACTCCGTGGCCTTCCTCGAGCCCGAGCCCGGCCCCGGCGACGGCAATGCC
GGGGCGCATGACTTCGACCGCCTCGACGACGATCAGCTCCTGTCCATGTTCTCCGACGACCTCCAACCGCCGCCGCCGCA
GCCGCAGACGCAGGCCGCGCCCGCGCCGGTGGCGAGCTCGTCGTCGCCGTCCGACCACAACAGCATCAACGACGAGAAGA
CGGATAGGGGCGACGCCGAGGAGGCACAGAGCAAGTGCCACGGCGCCGCCGCCACCGCCACCGCGGTGGATCCTAAGCGC
GTCAAGAGGATCCTGGCGAACCGGCAGTCCGCGCAGCGGTCGCGCGTGCGCAAGCTGCAGTACATCTCGGAGCTGGAGCG
CAGCGTCACGTCGCTCCAGACGGAGGTGTCGGCGCTGTCCCCGCGCGTGGCGTTCCTCGACCACCAGCGCTCGCTGCTGA
CGCTGGGGAACAGCCACCTGAGGCAGCGGATCGCGGCGCTCGCGCAGGACAAGATCTTCAAAGATGCTCATCAGGAGGCA
CTGAGGAAGGAGATCGAGAGGCTGAGGCAAATCTACCACCAGCAGAGCCTGAAGAGCGGCAGGGAGCCCGACGCGGCCCC
GTCGGTCCGCGACGACAAGGACATGATCGGCAGCGAGGGGACCGCCGCGCCCGGCCCGCCCTCG
TFome clones do not contain stop codon at 3'end.
Translation: MAQLPPKIPTVAPAWPEFGGGHQQQRSPSVGTFLAAAPMQPSWVDEFLDFSAAKRGAHRRSVSDSVAFLEPEPGPGDGNA
GAHDFDRLDDDQLLSMFSDDLQPPPPQPQTQAAPAPVASSSSPSDHNSINDEKTDRGDAEEAQSKCHGAAATATAVDPKR
VKRILANRQSAQRSRVRKLQYISELERSVTSLQTEVSALSPRVAFLDHQRSLLTLGNSHLRQRIAALAQDKIFKDAHQEA
LRKEIERLRQIYHQQSLKSGREPDAAPSVRDDKDMIGSEGTAAPGPPS
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map