TFome Information for pUT5455

TFome Name:pUT5455
Genbank Insert ID:KJ727595
Protein Name:ZmbZIP79
Species: Maize
TF Family: bZIP
Template: BT066129.1
Corresponding TF Gene: GRMZM2G030877
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.G468T p.E156D SNP not present in template FlcDNA, not present in functional domain.

5' Primer Name: C227_F 3' Primer Name: C227_R
5' Primer Sequence: caccATGGGGGATACTAGTAGTTCTAGCC 3' Primer Sequence: GAAGGTTGAAAATTGGTTTTGGGAT
5' Primer Tm (º C): 60.8 3' Primer Tm (º C): 54.7
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l primer reverse 20mM 1.25 l DMSO 100% 1 l DNA template (c=1 ng/l) 1 l MgCl2 50mM 1 l dNTPs 10mM 0.25 l phusion taq 13.5 l ultrapure water PCR program: 40 sec 98°C 35x : 15 sec 98°C 8 sec 65°C 40 sec 72°C 7 min 72°C leave at 10°C
Nucleotide Sequence: ATGGGGGATACTAGTAGTTCTAGCCATTCAAGGCAGGATCCTTCTCTTCTTGGCTATGGCTTCCATGGCGCCATCGCCAA
CTCCACTCCTCCTGCAAACTTCTTTGACCAAGGAGGAGGAGGCACCTATTTCGGAGAGCTGGAAGAAGCGTTCATGCATC
AGGTCGCCTCGCTCAGAAGAACTCAACAGGCTGCAACCGTCTCTGCACCTCATCATGGAGACACCAAGCCCTTTCCCACT
GCTGCTGGTGCTACAGCTGCAACGGCTACGGCTACGGCTAGGCCACCTCCTACACTGGACATCTTCCCAGCTTGGCCTAT
GAGGTCTCGTCTTCACACGCCCAAGGAGTGCTCGAATGTGACAGCAGACAGCACAGACGACTCGGAGAGCAGCAGCAAGA
ACCACAGCAACCACTCCTCAGACCAGCTCGGAGCAGCAGCAGCAGCAAACATGGCGAGCCAGTTCGATCAAGCTTCACAG
CAGCAGCTTCAGCACAAAAATATGGCTACAAGTTCCACTCCAAGAACTGGCAAGGCTCTTGATCCAAAGGTAATCAGAAG
GCTGGCTCAGAATCGTGAGGCTGCACGCAAAAGCCGGCTGCGGAAGAAGGCGTACATTCAGCAGCTCGAGAGCTGTAAGC
TGAAGCTTTCTCAGATGGAACAGGACATGCAGCGAGCCCGTACCCAGGGCCTCTTTCTTGGAGGAGATCCGGGTGCAAGC
ACCAGTTCAGGTGCCGCCATGTTTGACGTGGAGTACGCCCGGTGGCTGGACAACCACAGCCGGCGCCTGGCCGAGCTGAA
CGGAGCCCTACACGCGCACCTGGCAGACGGTGACCTCAGAGCCATCGTCGACGACGCCCTCACCCACCACGACGAGCTGT
TCCAGCTCAAGGCCATGGCGGCCAAATCCGACGTGTTCCACCTCATCACTGGGGTGTGGACGACCCCCGCCGAGCGCTGC
TTCCTCTGGATGGGTGGATTCAGGCCCTCCGATCTGCTCAAGACACTGCTGCCCCAGCTAGATCCACTGACAGAGCAGCA
AGTGGTCGGCATATGCAGCCTTCAGCAGTCATCACAGCAGGCAGAGGAAGCTCTCTCGCAGGGCTTGGAGCAGCTGCATC
AGTCGCTTGCTGACACCATGGCCGGTGGGTCTCTGACTGACGACGCCAACATGAGCTTCATGAGCCAAATGGCTCTTGCC
CTCGGCAAACTGGCCAACCTTGAAGGCTTTGTGATACAGGCCGATAACTTGAGGCAACAGACTCTTCATCAGATGCACCG
GATTCTGACAGTTCGGCAGGCAGCTCGATGTCTCTTGGCAATTGGCGAGTACCACAACCGCCTTCGTGCCTTAAGTTCCC
TCTGGGCTTCTAGACCTCGAGAGATACTGGTGACCGATGAAGGCAATTGTGAGATAAGCATCGCAGCACAACCATCCCAA
AACCAATTTTCAACCTTC
TFome clones do not contain stop codon at 3'end.
Translation: MGDTSSSSHSRQDPSLLGYGFHGAIANSTPPANFFDQGGGGTYFGELEEAFMHQVASLRRTQQAATVSAPHHGDTKPFPT
AAGATAATATATARPPPTLDIFPAWPMRSRLHTPKECSNVTADSTDDSESSSKNHSNHSSDQLGAAAAANMASQFDQASQ
QQLQHKNMATSSTPRTGKALDPKVIRRLAQNREAARKSRLRKKAYIQQLESCKLKLSQMEQDMQRARTQGLFLGGDPGAS
TSSGAAMFDVEYARWLDNHSRRLAELNGALHAHLADGDLRAIVDDALTHHDELFQLKAMAAKSDVFHLITGVWTTPAERC
FLWMGGFRPSDLLKTLLPQLDPLTEQQVVGICSLQQSSQQAEEALSQGLEQLHQSLADTMAGGSLTDDANMSFMSQMALA
LGKLANLEGFVIQADNLRQQTLHQMHRILTVRQAARCLLAIGEYHNRLRALSSLWASRPREILVTDEGNCEISIAAQPSQ
NQFSTF
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map