TFome Information for pUT5456

TFome Name:pUT5456
Genbank Insert ID:KJ727596
Protein Name:ZmbZIP84
Species: Maize
TF Family: bZIP
Template: BT085476.1
Corresponding TF Gene: GRMZM2G361611
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: C237_F 3' Primer Name: C237_R
5' Primer Sequence: caccATGGCTTCCTCCAGCGG 3' Primer Sequence: GCAGAGCTGGTACTCGAACATCATG
5' Primer Tm (º C): 63.1 3' Primer Tm (º C): 59.4
PCR Condition: PCR Reaction Mix: 5 l GC buffer (Thermo Fisher/ Finnzymes: contains 1.5 mM MgCl2) 1 l primer forward 20mM 1 l primer reverse 20mM 1.25 l DMSO 100% 1 l DNA template (c=1 ng/l) 1 l dNTPs 10mM 0.25 l phusion taq (NEB M0530L, now replaced by F-530) 14.5 l ultrapure water PCR program: 40 sec 98°C 30x : 15 sec 98°C 30 sec 70°C (DMSO conc. up to 10% decrease annealing temp. by 5.5-6.0°C) 40 sec 72°C 7 min 72°C leave at 4°C
Nucleotide Sequence: ATGGCTTCCTCCAGCGGGAGCGGGAGCGGGAGCTCGGGCTTCCTCTCGGCGGCGCTGGACTTGGCGGCGGCGGGAACGGA
GGAGGAGCTGCGCGCGCTCATGGCGCAGCGCCGCGCCAAGCGGATGCTGTCGAACCGCGAGTCGGCGCGGCGGTCGCGGA
TGCGCAAGCAGCGCCACCTGGACGAGCTCACGGCGCAGGCCGCGCACCTGCGCCGCGAGAACGCGCACGTGGCCACCGCG
CTCGGGCTCACCGCGCAGGGCCTCCTGGCCGTCGACGCCGACAACGCCGTCCTCCGCACCCAGGCCGCCGAGCTCGCCGC
GCGCCTCGGCTCCCTCAACGACATCCTCGCCTGCATGAACACCACCAACGCCGCCGCCGCCGCCGCTTTCTCCGACCCCT
ACCTCGCCTTCGACGGCGCCGCCACCGCCTTGGACGACCTCCTCAGATCCTGCCCCGACAGCATGATGTTCGAGTACCAG
CTCTGC
TFome clones do not contain stop codon at 3'end.
Translation: MASSSGSGSGSSGFLSAALDLAAAGTEEELRALMAQRRAKRMLSNRESARRSRMRKQRHLDELTAQAAHLRRENAHVATA
LGLTAQGLLAVDADNAVLRTQAAELAARLGSLNDILACMNTTNAAAAAAFSDPYLAFDGAATALDDLLRSCPDSMMFEYQ
LC
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map