TFome Information for pUT5527

TFome Name:pUT5527
Genbank Insert ID:KJ727616
Protein Name:ZmbZIP23
Species: Maize
TF Family: bZIP
Template: BT065699.1
Corresponding TF Gene: GRMZM5G821024
Transcript: T02
Vector: pENTR/SD/D-TOPO

5' Primer Name: C242_F 3' Primer Name: C242_R
5' Primer Sequence: caccATGGACCTGCGCTTCCCG 3' Primer Sequence: ACGTACCATCTCGGAGTTTAGCTTGTTCTTC
5' Primer Tm (º C): 70.3 3' Primer Tm (º C): 68.3
PCR Condition: PCR Reaction Mix:5 l GC buffer (NEB) 1 l primer forward 20mM 1 l primer reverse 20mM 1.25 l DMSO 100% 1 l DNA template (c=1 ng/l) 1 l MgCl2 50mM 1 l dNTPs 10mM 0.25 l phusion taq (NEB M0530L, now replaced by F-530) 13.5 l ultrapure water PCR program: 40 sec 98°C 33x : 15 sec 98°C 30 sec 65°C 40 sec 72°C 7 min 72°C leave at 4°C
Nucleotide Sequence: ATGGACCTGCGCTTCCCGCCGCCGGCGCCGTCGTCCTGCTTCGGCGGGGGCGGTGTGCTCCCGGCACGGGGGCACCACCG
GCGGGCGCAATCGGAGACGTTCATCCGGCTGCCCGACGCGGACCTCCTGCTGGACCCGGATGCCGACTTCGGCTTCTCCG
ACATCGACTTCCCCTCGCTGTCCGACGACTCGCCCGCGGCGTCCGACCCGACGCCGCAGCCGCAGGCCCCGCCACCCCAG
CAGCCGCTTCCGCAGGCGGCTTCGCCGGCGTCTGCGGCGCCGCCGAGGCCGCCGAGCGGAGCGCACATGCGGAGCCTCTC
CCTCGACGCCGCCTTCTTCGACGGCCTCTCGCTACAGGGAGGCGGGGGCGTGGCGGGGCACAAGAGGAGCGGCTCTATGG
ACGGGGCCACCTCGCCGTTCGAGGGCGAGTCCGCGCCGACGTCCGTGCTGCCGGACTACGCCAAGAAGGCCGTGCCCGAC
GACAGGCTCGCCGAGCTCGCGCTCCTCGACCCCAAGCGCGCCAAGAGGATCCTGGCGAACCGGCAGTCTGCGGCGAGGTC
CAAGGAGAGGAAGATCAAGTACACCAGTGAGCTGGAGAGGAAGGTGCAGACGCTGCAGACAGAGGCCACCACACTTTCGG
CACAGCTCACGCTTCTTCAGAGGGACACCTCTGGTTTAACCACTGAGAACAGGGAGCTGAAGCTCCGGCTGCAGGCCATG
GAAGAACAAGCTAAACTCCGAGATGGTACG
TFome clones do not contain stop codon at 3'end.
Translation: MDLRFPPPAPSSCFGGGGVLPARGHHRRAQSETFIRLPDADLLLDPDADFGFSDIDFPSLSDDSPAASDPTPQPQAPPPQ
QPLPQAASPASAAPPRPPSGAHMRSLSLDAAFFDGLSLQGGGGVAGHKRSGSMDGATSPFEGESAPTSVLPDYAKKAVPD
DRLAELALLDPKRAKRILANRQSAARSKERKIKYTSELERKVQTLQTEATTLSAQLTLLQRDTSGLTTENRELKLRLQAM
EEQAKLRDGT
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map