TFome Information for pUT5528

TFome Name:pUT5528
Genbank Insert ID:KJ727617
Protein Name:ZmbZIP102
Species: Maize
TF Family: bZIP
Template: BT085758.1
Corresponding TF Gene: GRMZM2G159134
Transcript: T02
Vector: pENTR/SD/D-TOPO
Note: c.G788T p.R263I. Not in template FlcDNA. Not in functional domain.

5' Primer Name: C256_F 3' Primer Name: C256_R
5' Primer Sequence: caccATGGGGAGCCAGACAATCG 3' Primer Sequence: GAAAGTCGCTGAGCCGGTTCTC
5' Primer Tm (º C): 62.2 3' Primer Tm (º C): 60.2
PCR Condition: PCR Reaction Mix: 5 l GC buffer (NEB) 1 l primer forward 20mM 1 l primer reverse 20mM 5 l glycerol 50% 1 l DNA template (c=1 ng/l) 1 l MgCl2 50mM 1 l dNTPs 10mM 0.25 l phusion taq (NEB M0530L, now replaced by F-530) 9.75 l ultrapure water PCR program: 40 sec 98°C 33x : 15 sec 98°C 30 sec 58°C 40 sec 72°C 7 min 72°C leave at 10°C
Nucleotide Sequence: ATGGGGAGCCAGACAATCGCATCACAGGCTGGGGGAGGTGGAAGAGGCATGGGTAGTAGTGGTGGTGCCGGTGCAGCGCA
ACGCGGGCAGATGCAGAGTCTGGCAAGACAAGGGTCTCTGTATAACCTTACCCTTGATGAGGTGCAGAGCCATTTGGGAG
AACCCCTACACAGCATGAACCTTGAGGAGCTGCTGAAGAGTGTCTTTCCTGATGACCTGGACCCTGATGGTGGCACTACC
AGCCAATATGAGCAGAGTTCGGGCCTCTTGCGACAGGGAAGTATCACAATGCCGCCTGAGCTCAGCAGGAGAACTGTGGA
CGAGGTGTGGAAGGACATCCAGGATGCACCAAACAGAAATGTTGGGGAGAGTGGTCGGCGGAAGCGGGAGCGGCAGCCAA
CGCTTGGAGAGATGACGCTTGAGGATTTCTTGGTGAAAGCTGGGGTTGTCGCCGAAGGATATCTGAAGGACTTGAATGGC
ATAGGCAGTGTGGAACAGGTTGGTAGCACTGGGGCTGCGGGTTTGACAGCAGGGGCACAATGGTTAGACCACTATCAGCA
GCGGATTACAGCTATCGAGCCCCATCAGCACAGGCAACATAGTTTGCCAGGTGCTTACATACCGGGTCAGTTAAGCCTTC
AGTCCCTGAATGTTGGACCAAGTGCTATTTTGGAGTCATACTCTGATGGCCACATTTCTTCACCGATGATGGGTGCACTT
TCTGATTCTCCGATGCCTGGTAGAAAGCGTGGTTCCCCAGGAGATGTGGCTGATAAGTTGGTGGAGATAAGGCAGAAGAG
GATGATCAAGAATAGGGAGTCAGCTGCTCGTTCAAGGGCTAGGAAGCAGGCATACACTAATGAACTGGAAAACAAGGTTT
CTCGATTAGAAGAGGAGAATAAGAAGCTAACCACGTTAAAGGAGTTGGAAAATATACTTTTCTCTGAGCCTCTTCCGGAA
CCCAAGTACCAACTGAGGAGAACCGGCTCAGCGACTTTC
TFome clones do not contain stop codon at 3'end.
Translation: MGSQTIASQAGGGGRGMGSSGGAGAAQRGQMQSLARQGSLYNLTLDEVQSHLGEPLHSMNLEELLKSVFPDDLDPDGGTT
SQYEQSSGLLRQGSITMPPELSRRTVDEVWKDIQDAPNRNVGESGRRKRERQPTLGEMTLEDFLVKAGVVAEGYLKDLNG
IGSVEQVGSTGAAGLTAGAQWLDHYQQRITAIEPHQHRQHSLPGAYIPGQLSLQSLNVGPSAILESYSDGHISSPMMGAL
SDSPMPGRKRGSPGDVADKLVEIRQKRMIKNRESAARSRARKQAYTNELENKVSRLEEENKKLTTLKELENILFSEPLPE
PKYQLRRTGSATF
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map