TFome Information for pUT5629

TFome Name:pUT5629
Genbank Insert ID:KJ727690
Protein Name:ZmbHLH171
Species: Maize
TF Family: bHLH
Template: BT087988
Corresponding TF Gene: GRMZM2G024530
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: UT3296up 3' Primer Name: UT3296dn
5' Primer Sequence: caccATGGACTTCTCAGCTGGTTCCTACTTCA 3' Primer Sequence: CTGTTCGGGAGGGATTGACGC
5' Primer Tm (º C): 63.7 3' Primer Tm (º C): 60.4
PCR Condition:
Nucleotide Sequence: ATGGACTTCTCAGCTGGTTCCTACTTCACATCATGGCCTGTCAATTCTGCTTCTGAGAGCTACAGTTTGGCTGATGGTTC
AGTTGAATCCTATGGAGGAGAAGGAATCATGCCACCTTCAAGCTACTTCATGACAGCCAGATCAGATCACAATTTAAAAT
TCAGTGTGCATGAACAGGATTCCACTATGCTTCCAAACGACCAATTGACCTATGCTGGCGCTAGGCAGACTGATCTATTA
CCTGGCGAGACTCCATCTAGGGATAAGCTTTGTGAGAATCTTCTGGAGCTTCAACGACTGCAGAATAACAGCAGCCTACC
GAGTAATTTAGTGCCCCCAGGGGTACTTCAGCACAATTCAACACCTGGGGCCTTTCATCCGCAGTTGAATACTCCTGGAC
TTTCAGAACTGCCTCATGCCTTATCTAGTTCAATTGATAGTAATGGAAGTGAAGTTTCTGCTTTTCTCGCTGATCTAAAT
GCTGTTTCTTCAGCCTCAGCTTTGTGTTCCACATTCCAAAATGCTTCTTCATTCATGGAACCAGTAAATCTAGAAGCTTT
CAGTTTTCAAGGGGCACAAAGTGATTCTGTTTTGAACAAAACAACACATCCAAATGGGAATATCTCAGTATTTGACAGTG
CTGCCTTGGCATCACTACATGATAGCAAAGAGTTTATCAGTGGTAGGCTCCCCTCATTTGCTAGTGTCCAGGAAACAAAC
GTAGCTGCTAGTGGTTTCAAGACTCAGAAGCAGGAGCAAAATGCAGTGTGCAACGTTCCTATCCCTACGTTCACTGCACG
TAATCAAATTGCAGTTGCTGCAATGCCCGGATCACTGATCCCTCAAAAGATTCCTTCATGGATCAATGAAAACAAAAGTG
AGGGTCCTGTTAGCCATCCTTCTGATGTACAAATCCAACCAAATTCTGTTGGAAATGGTGTTGGTGTGAAGCCACGAGTA
AGGGCTCGTCGTGGACAGGCAACTGATCCTCATAGCATTGCTGAACGACTTCGCAGAGAAAAAATTTCAGATAGGATGAA
AAATCTACAAGATCTTGTCCCGAATTCTAATAAGGCAGACAAGGCATCCATGCTGGATGAAATCATTGATCATGTGAAAT
TTCTTCAGCTTCAGGTCAAGGTGTTAAGCATGAGTAGGCTAGGAGCTCCAGGAGCAGTTCTTCCCCTTCTCGCAGAATCT
CAGACTGAGGGTTACCGCGGTCAACTTCTGTCAGCTCCAACCAACGCACAAGGATTACTGGACACGGAAGAATCGGAAGA
CACCTTCGCCTTCGAGGAAGAGGTTGTGAAGCTAATGGAAACCAGCATCACAAGCGCAATGCAGTACCTTCAGAACAAGG
GACTCTGCCTGATGCCAGTTGCCCTTGCTTCCGCCATATCCACCCAGAAGGGCGTCTCCGCCGCGTCAATCCCTCCCGAA
CAG
TFome clones do not contain stop codon at 3'end.
Translation: MDFSAGSYFTSWPVNSASESYSLADGSVESYGGEGIMPPSSYFMTARSDHNLKFSVHEQDSTMLPNDQLTYAGARQTDLL
PGETPSRDKLCENLLELQRLQNNSSLPSNLVPPGVLQHNSTPGAFHPQLNTPGLSELPHALSSSIDSNGSEVSAFLADLN
AVSSASALCSTFQNASSFMEPVNLEAFSFQGAQSDSVLNKTTHPNGNISVFDSAALASLHDSKEFISGRLPSFASVQETN
VAASGFKTQKQEQNAVCNVPIPTFTARNQIAVAAMPGSLIPQKIPSWINENKSEGPVSHPSDVQIQPNSVGNGVGVKPRV
RARRGQATDPHSIAERLRREKISDRMKNLQDLVPNSNKADKASMLDEIIDHVKFLQLQVKVLSMSRLGAPGAVLPLLAES
QTEGYRGQLLSAPTNAQGLLDTEESEDTFAFEEEVVKLMETSITSAMQYLQNKGLCLMPVALASAISTQKGVSAASIPPE
Q
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map