TFome Information for pUT5630

TFome Name:pUT5630
Genbank Insert ID:KJ727691
Protein Name:ZmbHLH16
Species: Maize
TF Family: bHLH
Template: BT064573
Corresponding TF Gene: GRMZM2G021276
Transcript: T02
Vector: pENTR/SD/D-TOPO

5' Primer Name: UT3335up 3' Primer Name: UT3335dn
5' Primer Sequence: caccATGTATCACCCGCAGTGCGAGCT 3' Primer Sequence: GTACTCGTCCACCACTTCCATCAGCC
5' Primer Tm (º C): 59.3 3' Primer Tm (º C): 57.7
PCR Condition:
Nucleotide Sequence: ATGTATCACCCGCAGTGCGAGCTCCTGACGATGGCGCACGAAACGCCGGACCTGGACGCCGGCCAGCCGCACCTAACCGT
CTCCGGCGTCGCCAGCATCCCGGCAGAGCTGAGCTTCCACCTGCTGCACTCGCTCGACGCCGCGGCGGCGGTCAATCCCG
TCACGGCGCCGCCGCAGTCCACCATCGACTACTTCCTCGGCGGCGCCGATCCCCACCAGCAGGCCATGCAGTACGAGCCG
CTGCCGCCCGCCGCGGGCGGCCACCACCAGTACACCATGGACATGTTCCGCGACTACTGCGACGGCCACTACCCCACCGC
CGAGCCGTACATCCGCGGGACAATGACTGGAGCCCTCGTGTTCGGGGCCACCGACGACGACGACTCGGCCGCTGCCTACA
TGCCCGGGGGGCACTTTGAGACCTCCCCGCCGCCGCCACGCGCCACCGGCCGCGGCAGGAAGCGGGGCAGGGCGCTGGGC
GGCGGCTTCCATGCTGTGCTGGCCAACGGCGTCGAGAAGAAGGAGAAGCAGCGCCGGCTGCGGCTCACCGAGAAGTACAC
CGCCCTCATGCACCTCATACCCAACGTTACAAAGACTGATAGGGCGACGGTGATCTCGGACGCGATCGAGTACATCCAGG
AGCTGGGGAGGACGGTGGAGGAGCTGACGCTGCTGGTGGAGAAGAAGCGGCGCCGGAGGGAGCTGCAGGGGGACGTCGTG
GACGCGGCGCCGGCTGCGGTGGTTGCTGCCGCCGGTGAGGCGGAGAGCTCGGAGGGCGAGGTGGCTCCTCCGCCGCCGGC
CGTGCCGCGGCAGCCGATCCGGAGCACGTACATCCAGCGGCGGAGCAAGGACACGTCCGTGGACGTGCGGATCGTGGAGG
AGGACGTGAACATCAAGCTCACCAAGCGCCGGCGCGACGGGTGCCTCGCAGCCGCGTCGCGCGCGCTGGATGACCTCCGC
CTTGACCTCGTCCACCTCTCCGGCGGCAAGATCGGTGACTGTCAAATCTACATGTTCAACACCAAGATTCACAAGGGGTC
TTCAGTGTTTGCGAGTGCAGTGGCCGGTAGGCTGATGGAAGTGGTGGACGAGTAC
TFome clones do not contain stop codon at 3'end.
Translation: MYHPQCELLTMAHETPDLDAGQPHLTVSGVASIPAELSFHLLHSLDAAAAVNPVTAPPQSTIDYFLGGADPHQQAMQYEP
LPPAAGGHHQYTMDMFRDYCDGHYPTAEPYIRGTMTGALVFGATDDDDSAAAYMPGGHFETSPPPPRATGRGRKRGRALG
GGFHAVLANGVEKKEKQRRLRLTEKYTALMHLIPNVTKTDRATVISDAIEYIQELGRTVEELTLLVEKKRRRRELQGDVV
DAAPAAVVAAAGEAESSEGEVAPPPPAVPRQPIRSTYIQRRSKDTSVDVRIVEEDVNIKLTKRRRDGCLAAASRALDDLR
LDLVHLSGGKIGDCQIYMFNTKIHKGSSVFASAVAGRLMEVVDEY
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map