TFome Information for pUT5633

TFome Name:pUT5633
Genbank Insert ID:KJ727694
Protein Name:ZmABI12
Species: Maize
TF Family: ABI3-VP1
Template: gDNA
Corresponding TF Gene: GRMZM2G102059
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: Dup3 3' Primer Name: Ddn3
5' Primer Sequence: caccATGGAGTTCGCGAGCTCTTCGAG 3' Primer Sequence: CAGATCGAGATCCAAGGACGAGTGC
5' Primer Tm (º C): 60.9 3' Primer Tm (º C): 60.7
PCR Condition:
Nucleotide Sequence: ATGGAGTTCGCGAGCTCTTCGAGTAGGTTTTCCAGGGAGGAGGACGAGGAGGAAGAGCAGGAGGAAGAGGAGGAGGAGGA
GGAGGCGTCTCCGCGCGAGATCCCCTTCATGACAGCGGCAGCGACGGCCGACACCGGAGCCGCCGCCTCCTCGTCCTCGC
CTTCCGCGGCGGCCTCATCGGGTCCTGCTGCTGCCCCCCGCTCGAGCGACGGCGCCGGGGCGTCCGGGAGCGGCGGCGGC
GGGAGCGACGACGTGCAGGTGATCGAGAAGGAGCACATGTTCGACAAGGTGGTGACGCCCAGCGACGTGGGGAAGCTCAA
CCGGCTGGTGATCCCGAAGCAGCACGCGGAGAAGTACTTCCCGCTGGACGCGGCGGCCAACGAGAAGGGCCAGCTGCTCA
GCTTCGAGGACCGCGCCGGTAAGCTCTGGCGCTTCCGCTACTCCTACTGGAACAGCAGCCAGAGCTACGTCATGACCAAG
GGCTGGAGCCGCTTCGTCAAGGAGAAGCGCCTCGACGCCGGCGACACCGTCTCCTTCTGCCGCGGCGCCGGCGACACCGC
GCGGGACCGCCTCTTCATCGACTGGAAGCGCCGCGCCGACTCCCGCGACCCGCACCGCATGCCGCGCCTCCCGCTCCCCA
TGGCGCCCGTCGCGTCGCCCTACGGCCCCTGGGGCGGCGGCGGCGGCGGCGGCGCGGGCGGTTTCTTCATGCCGCCCGCG
CCGCCCGCCACACTCTACGAGCACCACCGCTTCCGCCAGGCCCTCGACTTCCGCAACATCAACGCCGCGGCCGCGCCGGC
CAGGCAGCTCCTCTTCTTCGGCTCAGCCGGCATGCCCCCGCGCGCGTCCATGCCGCAGCAGCAGCAGCCGCCTCCGCCCC
CGCACCCGCCTCTGCACAGCATTATGTTGGTGCAACCCAGCCCCGCGCCGCCCACGGCCAGCGTGCCCATGCTTCTCGAC
TCGGTACCGCTCGTCAACAGCCCAACGGCAGCGTCGAAGCGCGTCCGCCTGTTTGGGGTCAACCTCGACAACCCGCAACC
AGGCACAAGTGCGGAGTCAAGCCAAGATGCCAACGCATTGTCGCTGAGGACACCGGGATGGCAAAGGCCGGGGCCGTTGA
GGTTCTTCGAATCGCCTCAACGCGGCGCCGAGTCATCTGCAGCCTCCTCGCCGTCGTCATCGTCGTCCTCCAAGAGAGAA
GCGCACTCGTCCTTGGATCTCGATCTG
TFome clones do not contain stop codon at 3'end.
Translation: MEFASSSSRFSREEDEEEEQEEEEEEEEASPREIPFMTAAATADTGAAASSSSPSAAASSGPAAAPRSSDGAGASGSGGG
GSDDVQVIEKEHMFDKVVTPSDVGKLNRLVIPKQHAEKYFPLDAAANEKGQLLSFEDRAGKLWRFRYSYWNSSQSYVMTK
GWSRFVKEKRLDAGDTVSFCRGAGDTARDRLFIDWKRRADSRDPHRMPRLPLPMAPVASPYGPWGGGGGGGAGGFFMPPA
PPATLYEHHRFRQALDFRNINAAAAPARQLLFFGSAGMPPRASMPQQQQPPPPPHPPLHSIMLVQPSPAPPTASVPMLLD
SVPLVNSPTAASKRVRLFGVNLDNPQPGTSAESSQDANALSLRTPGWQRPGPLRFFESPQRGAESSAASSPSSSSSSKRE
AHSSLDLDL
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map