TFome Information for pUT5637

TFome Name:pUT5637
Genbank Insert ID:KJ727698
Protein Name:ZmbHLH57
Species: Maize
TF Family: bHLH
Template: gDNA
Corresponding TF Gene: GRMZM2G159937
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: R49F 3' Primer Name: R49R
5' Primer Sequence: caccATGGCGTGGTCGGAGACGGACG 3' Primer Sequence: CGGGGAGGGGGTGGCGCTGGTCA
5' Primer Tm (º C): 68.3 3' Primer Tm (º C): 72
PCR Condition:
Nucleotide Sequence: ATGGCGTGGTCGGAGACGGACGCCGCGCTGTTCGCGGCGGTGCTGGGGCGGGACGCGGCGCACCACCTGAGCACCACGCC
GCCGCACCAGGACGCGCCCGCGGCGTCGGCCCCCGAGCTCCAGGCGCGCCTGCAGGACCTCGTGGAGCGGGGCGGGGCGT
GGACGTACGGCATCTTCTGGCAGGAGTCCTGCGCCGGCGGCCGCGCCGTGCTCGGCTGGGGCGACGGCCACTGCCGCGAC
GGCGGCGCCCCGCACCACGACGACGCGGACCGGAGCGTGGCGCGGAAGCGCGCGCTGCTGCGGCTGCACGCGCTCTACGG
CGGCGGGGACGACGAGGGGGCCGACTACGCGCTCCGCCTCGACCGGGTCACCGCCGCCGAGATGTACTTTCTGGCGTCCA
TGTACTTCTCCTTCCCGGAGGGCGCGGGCGGGCCGGGCCACGCGCTCGCCACGGCCCGCCACGCCTGGGCCACCGTCGAC
CCCGCGCCCGGGTGGTACGTCCGGGCGTCCCTCGCCCAGTCCGCGGGGCTCCGCACCGTCGTCTTCCTCCCGTGCAAGGG
CGGCGTCCTCGAGCTCGGCTCCGCCGTGCCCGTCCGCGAGACTCCCGAGACCCTGCGCGCGCTCCAGACCGCGCTCGCTG
TCGCGCGGCCCCCGGCACGCGAGGAATGCATGAGGATCTTCGGCCAGGACCTCTCCCCCGGCGGGAGCGCCCGAGCCCCG
CGCAGCGTCGACAATTGGGCTCCACATCCACACCTCGCCGCCCAAGCCACCGCCGCGTCCGCACTAGCCAGCAAGGAAGC
CGCCGCGGGACACAAGGCTCCGGAGCCGCCCAGGAGCATAGACTTCAGCAAGCCAGGGAAGCCTGGGCACGGGCAGGCCG
GCGGCGAGGAGCGGAGGCCGCGGAAGCGCGGGCGGAAGCCGGCGAACGGGCGGGAGGAGCCACTGAACCACGTGGAGGCG
GAGCGGCAGCGGCGGGAGAAGCTGAACCAGCGGTTCTACGCCCTGCGCGCCGTCGTCCCCAAGATTTCCAAGATGGACAA
GGCGTCGTTGCTCAGCGACGCCATCGCGTACATCCAGGAGCTGGAGGACCGGCTCCGCGGCGGCGGCGGCGGCGGCGGCG
GCTGCTCGGCGGCGCGCCCGGACAGCCCGGACGTGGAGGTGAAGGCAATGCAGGACGAGGTGGTGCTGCGCGTGACCACG
CCCCTGTACGCGCACCCCGTCTCCAGGGTGTTCCACGCCATCAGGGACGCCGAGCTGATCGTGGCGGCGTCGGACGTGGC
GGTGGCGGACGAAGCCGTCACGCACACGCTCGTGCTGCGGTCGCCCGGCCCCGAGCAGCTCACCGCGGAGACGGTACTCG
CCGCCATGTCACGGGGGATGACCAGCGCCACCCCCTCCCCG
TFome clones do not contain stop codon at 3'end.
Translation: MAWSETDAALFAAVLGRDAAHHLSTTPPHQDAPAASAPELQARLQDLVERGGAWTYGIFWQESCAGGRAVLGWGDGHCRD
GGAPHHDDADRSVARKRALLRLHALYGGGDDEGADYALRLDRVTAAEMYFLASMYFSFPEGAGGPGHALATARHAWATVD
PAPGWYVRASLAQSAGLRTVVFLPCKGGVLELGSAVPVRETPETLRALQTALAVARPPAREECMRIFGQDLSPGGSARAP
RSVDNWAPHPHLAAQATAASALASKEAAAGHKAPEPPRSIDFSKPGKPGHGQAGGEERRPRKRGRKPANGREEPLNHVEA
ERQRREKLNQRFYALRAVVPKISKMDKASLLSDAIAYIQELEDRLRGGGGGGGGCSAARPDSPDVEVKAMQDEVVLRVTT
PLYAHPVSRVFHAIRDAELIVAASDVAVADEAVTHTLVLRSPGPEQLTAETVLAAMSRGMTSATPSP
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map