TFome Information for pUT5648

TFome Name:pUT5648
Genbank Insert ID:KJ727709
Protein Name:ZmbZIP82
Species: Maize
TF Family: bZIP
Template: gDNA
Corresponding TF Gene: GRMZM2G137532
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: SE0060_F 3' Primer Name: SE0060_R
5' Primer Sequence: caccATGATCGCCGTGCCGCC 3' Primer Sequence: AAACGGGAAGATAAGATTGAATTTATTCAGTAGCAGTG
5' Primer Tm (º C): 66.1 3' Primer Tm (º C): 59.8
PCR Condition: Step 1, 98°C 3 min melt, 1 cycle; Step 2, 98°C 40 sec melt, 72°C 60 sec extend, 35 cycles; Step 3, 72°C 10 min extend 1 cycle; 1ul Phusion (Thermo Scientific), GC buffer (Thermo Scientific), MgCl2 3 mM final concentration,5% DMSO, template 50ng/ul final concentration.
Nucleotide Sequence: ATGATCGCCGTGCCGCCCACTCCATTATTCCACCCTCCTCCTCCTACCTTTGAACCTCCTATCCACGAAGCACCGGCTGT
CGCCGCCGCCGGCAACAGCCCAGCCGGCTCCGGCAGCAGCACCGATGACGCTTACGGCGGCCGCACGGCAATGGCGGAGG
CTGAGCGGAGGCGGCGGAGGATGGTCTCCAACCGGGAGTCGGCCAGGAGGTCACGCATGCGCAAGCAGCGGCAGCTCACC
GAGCTGTGCGCGCAGGTCGTCCACCTCCGCGGTGCCAACCGCCGCCGCCTCGACGAGCTGAACCGCGCACTGAGGGGCTG
CAGTGACATGTGCTGCGAGAACGCCCGGCTCCAGAAAGAGAAGACCGATCTCAGTACCAAGCTCGAGCGCCTCACCCAGG
CGCAGAACGCCGCCACGCCAAGCTCCTCCTCGGAGCCGCAACATGACACATTGACACTGCTACTGAATAAATTCAATCTT
ATCTTCCCGTTT
TFome clones do not contain stop codon at 3'end.
Translation: MIAVPPTPLFHPPPPTFEPPIHEAPAVAAAGNSPAGSGSSTDDAYGGRTAMAEAERRRRRMVSNRESARRSRMRKQRQLT
ELCAQVVHLRGANRRRLDELNRALRGCSDMCCENARLQKEKTDLSTKLERLTQAQNAATPSSSSEPQHDTLTLLLNKFNL
IFPF
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map