TFome Information for pUT5673

TFome Name:pUT5673
Genbank Insert ID:KJ727733
Protein Name:ZmbZIP73
Species: Maize
TF Family: bZIP
Template: BT069784.1
Corresponding TF Gene: GRMZM2G175870
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.A152G p.H51R Not present in template FlcDNA. Not in functional domain.

5' Primer Name: B531_F 3' Primer Name: B531_R
5' Primer Sequence: caccATGGACGATGGAGCTGACCTC 3' Primer Sequence: TTCAGCCAGGGGATCAGAACTCAC
5' Primer Tm (º C): 62.9 3' Primer Tm (º C): 60.6
PCR Condition: PCR Reaction Mix:5 l GC buffer (NEB) 1 l primer forward 20mM 1 l primer reverse 20mM 1.25 l DMSO 100 50% 1 l DNA template (c=1 ng/l) 1 l dNTPs 10mM 0.25 l phusion taq (FL-530) 14.5 l ultrapure water PCR program: 40 sec 98°C 30x : 15 sec 98°C 30 sec 60°C 30 sec 72°C 7 min 72°C leave at 4°C
Nucleotide Sequence: ATGGACGATGGAGCTGACCTCCCCTGCCAACTGCTCTTCTCCCACCCGGAGATGCCTGACAGCTTCGACGAGTTCTTCAA
CAGCGCCACGACGACCTGCACCCACACGCACAGCTGCAACCCGCCCGGCCCCTCGGTCGCCATGCACACCCGCACGTGCC
TGCACGCGCACACCCTGGTCCTGGGCAGCGGCGGGGAGGACGACGACGACGCCAGGGAGGACTCGGCGAAGCCGCGCAGA
CCGCTGGGGAACAGGGAAGCTGTGCGCAAGTACCGGGAGAAGAAGAAGGCGCACGCGGCCTTTCTGGAAGAGGAGGTCAA
GAAGCTCCGCGCCGCCAACCAGCAGCTCCAGAGACGGCTGCAGGGCCATGCAGCTTTGGAGGCGGAGGTGGCGAGGCTCC
GGGGTCTCCTGCTCGATATCCGGGGCAAGATCGACGCCGAGGTCGGCGGCGTGCTCCCTTTTCAGAAGCCGTGCAGTGTG
GGCTCCGTGGCGTGTGCCGATCCTGCTCTGTGCTTCAACGGCAACTCGGAGGTTGGAGGCGGCTGGGAGGAGAGCTCAAG
ACCGGCAGCCGCGGACTGCAGGATCGATGAAGTGCGAGGGATGTCACGGGAAATTGATGTCCCAGAAGGCTTGCGTCATT
CCATGGATGTTGTTGCGAGCTTCGTGAGTTCTGATCCCCTGGCTGAA
TFome clones do not contain stop codon at 3'end.
Translation: MDDGADLPCQLLFSHPEMPDSFDEFFNSATTTCTHTHSCNPPGPSVAMHTRTCLHAHTLVLGSGGEDDDDAREDSAKPRR
PLGNREAVRKYREKKKAHAAFLEEEVKKLRAANQQLQRRLQGHAALEAEVARLRGLLLDIRGKIDAEVGGVLPFQKPCSV
GSVACADPALCFNGNSEVGGGWEESSRPAAADCRIDEVRGMSREIDVPEGLRHSMDVVASFVSSDPLAE
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map