TFome Information for pUT5681

TFome Name:pUT5681
Genbank Insert ID:KJ727740
Protein Name:ZmARF16
Species: Maize
TF Family: ARF
Template: RT-PCR
Corresponding TF Gene: GRMZM2G028980
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: R1-F 3' Primer Name: R1-R
5' Primer Sequence: caccATGAAGCTCTCGCCGTCGGCCA 3' Primer Sequence: GAACTCGACCGAACCCACCGGC
5' Primer Tm (º C): 68.22 3' Primer Tm (º C): 64.59
PCR Condition:
Nucleotide Sequence: ATGAAGCTCTCGCCGTCGGCCAGCGGTGGCCTCCAGGACCAGCCGGCGTCGCCGGAAGAAGCTGAAGAGCACAAGTGCCT
GAATTCTGAGTTGTGGCATGCATGTGCTGGCCCTCTAGTTTCATTGCCTTCGGTCGGTAGTCGAGTGGTGTATTTTCCTC
AAGGCCACGGTGAGCAGGTAGCAGCATCAACAAATAAGGAAATGGAGGCTCAGATCCCCAACTATCCTAGTCTACCTCCG
CAGCTTATATGCCAACTGCATAATGTGACTATGCATGCTGATGCTGAGACAGATGAGGTGTATGCACAGATGACACTCCA
GCCACTCAGTCCACAAGAGCTCAAGGACCCATTTTTGCCTGCTGAGTTAGGCACTGCCAGCAACCAGCCAACAAATTATT
TTTGTAAAACACTAACTGCAAGTGATACGAGTACACATGGTGGGTTCTCTGTTCCACGCCGAGCAGCTGAGAAGGTGTTT
CCTCCACTGGATTTCAATCAGCAACCTCCCGCACAGGAGTTGATTGCAAAAGATCTTCATGGCAACGACTGGAAATTTCG
CCATATTTTTCGAGGTCAGCCAAAGCGGCATCTTCTGACAACAGGTTGGAGTGTCTTTGTTAGTGCAAAGAGACTGGTTG
CTGGCGACTCTGTCCTTTTTATCTGGAATGACAACAACCAGCTGCTTCTGGGAATTCGCCGGGCAAACAGACCACAAACC
GTCATGCCATCATCAGTACTTTCTAGTGATAGCATGCATATTGGCCTGCTCGCTGCTGCAGCTCATGCTGCATCAACAAA
TAGCCGGTTTACTATCTTCTATAATCCAAGAGCAAGCCCTTGTGAATTTGTCATACCCATGGCTAAGTATGTGAAAGCTG
TGTACCATACCCGTATATCTGTGGGCATGCGTTTCCGGATGCTTTTTGAGACGGAGGAATCTAGTGTAAGGCGTTATATG
GGGACAATTACAGGAATAAGTGATCTTGATCCTGTTCGCTGGCCAAACTCGCACTGGCGCTCAGTAAAGGTTGGATGGGA
CGAGTCAACTGCTGGAGAGAAGCAGCCAAGGGTATCTCTTTGGGAGATTGAACCGTTGACAACTTTTCCAATGTATCCAT
CTCCTTTTGCTCTTGGATTAAAGCGCCCATGGCCTGCAGGCCTGCCTTCTTTATACGGTGGAAGGGGTGATGGCTTGACC
TCTTCTCTTATGTGGCTTCGAGACAGGGCAAACCCGGGTTTCCAGTCACTGAATTTCAGCGGGCTTGGTATGAGTCCCTG
GATGCAGCCTAGGCTGGATAATTCCTTACTTGGTCTCCAATCTGACATGTACCAGACCATAGCAGCAGCAGCAGCATTAC
AAAGCACTACGAAGCAAGTTCCACCTTCAGCAATGCAGTTCCAACAGCCTCAGAACATTGCTGATAGATCTGCTCTTCTA
TCAAGTCAGATTCTGCAGCAAGTACAACCTCGGTTTCAGCAAATTTACCCTCAAAATCTCAACGAAAACAAAATTCAAGG
TCATACACAACCTGAGTACCTCCAAGTCCAACAGCAGCTTCAACGCTGCCAATCATTTAATGAGCAGAAGCCTCCGATGC
ATCCACAGCAACAACAGCAGGAACCACAGCAGCAGCAATGCGTCCAAACACCACAGGATCAACAAATGCAAGAACAGAAG
CATCTGCACAACTTCCACTCCTTGCCAGATGCATTATCGGCCTTTTCTCAGCTTTCCCCAGCCACTCACTCCCCACCTTC
CGCATTGCAGACAGTTCCAGCATTCTCGCATCAACAAAACTTCCCAGATACAAACATTAGCTCTCTCTCACCATCTACTG
GCCCTTCAATGCATGGCATGTTGGGGAGATTACCTTCCGAAGCAGCTTCGAGCCTCCCATGTGTGGCAATGAACGCCCCT
GTATCGGTATCTGACCCATGGTCATCCAAGAGAGTTGCAGTGGAGTCTGTTAACCCTTGTCGACCTCATGTTTCACCACA
TATAGAACATTTGGATATGGCGACGTGTAACATGCCGCAGAGCTCTGCACTAGCACCATTACCTGGACGGGAATGCCTAG
TGGATGAAGATGGGTGCTCTGATCCTCAAAATCACCTCTTGTTTGGTGTTCACATAGACTCGCATTCACTTCTGATGCAA
GGGGGCATTCCAGCCCTTCAGAATGATAACAGTTCAGGCACTATTCCATACTCAACCTCCAATTTCCTGAGCCCTTCTGA
GAACGATTTCCCCTTGAATCAACCGCTACGCAGCGCGGGCTGCTTAGATGAGTCGGATTATCTTCCATGTGCAGAGAATG
CCGAACAGGCAAATCAACAGTTTGCAACCTTTGTGAAGGTTTACAAATCCGGGACCGTCGGAAGGTTGCTCGACATCACT
AGATTCAGCAGCTACGACGAGCTCCGTAGCGAGGTGGGGCGTCTGTTTGGCCTCGAGGGCCAGCTGGAAGACCCTCTGAG
ATCAGGCTGGCAGCTTGTATTTGTTGACAGGGAGGACGATGTCCTTCTGGTTGGCGATGACCCATGGCAGGAATTCGTGA
ACAGTGTGTCCTGTATAAAGATACTTTCACCGGAGGAGGTCCAGCGGATGGGAAAGCCGGGCATCCAGCTCCTGAGCTCG
GCTCCTTCAAGAAGGCTGGGCAATGGCTGCGACAGCTACGCGAGCATGCAGGAGCCGAGAGGCCTGGACGCTGGGATGGC
GCCGGTGGGTTCGGTCGAGTTC
TFome clones do not contain stop codon at 3'end.
Translation: MKLSPSASGGLQDQPASPEEAEEHKCLNSELWHACAGPLVSLPSVGSRVVYFPQGHGEQVAASTNKEMEAQIPNYPSLPP
QLICQLHNVTMHADAETDEVYAQMTLQPLSPQELKDPFLPAELGTASNQPTNYFCKTLTASDTSTHGGFSVPRRAAEKVF
PPLDFNQQPPAQELIAKDLHGNDWKFRHIFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNDNNQLLLGIRRANRPQT
VMPSSVLSSDSMHIGLLAAAAHAASTNSRFTIFYNPRASPCEFVIPMAKYVKAVYHTRISVGMRFRMLFETEESSVRRYM
GTITGISDLDPVRWPNSHWRSVKVGWDESTAGEKQPRVSLWEIEPLTTFPMYPSPFALGLKRPWPAGLPSLYGGRGDGLT
SSLMWLRDRANPGFQSLNFSGLGMSPWMQPRLDNSLLGLQSDMYQTIAAAAALQSTTKQVPPSAMQFQQPQNIADRSALL
SSQILQQVQPRFQQIYPQNLNENKIQGHTQPEYLQVQQQLQRCQSFNEQKPPMHPQQQQQEPQQQQCVQTPQDQQMQEQK
HLHNFHSLPDALSAFSQLSPATHSPPSALQTVPAFSHQQNFPDTNISSLSPSTGPSMHGMLGRLPSEAASSLPCVAMNAP
VSVSDPWSSKRVAVESVNPCRPHVSPHIEHLDMATCNMPQSSALAPLPGRECLVDEDGCSDPQNHLLFGVHIDSHSLLMQ
GGIPALQNDNSSGTIPYSTSNFLSPSENDFPLNQPLRSAGCLDESDYLPCAENAEQANQQFATFVKVYKSGTVGRLLDIT
RFSSYDELRSEVGRLFGLEGQLEDPLRSGWQLVFVDREDDVLLVGDDPWQEFVNSVSCIKILSPEEVQRMGKPGIQLLSS
APSRRLGNGCDSYASMQEPRGLDAGMAPVGSVEF
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map