TFome Information for pUT5682

TFome Name:pUT5682
Genbank Insert ID:KJ727741
Protein Name:ZmARF27
Species: Maize
TF Family: ARF
Template: RT-PCR
Corresponding TF Gene: GRMZM2G160005
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: R6-F 3' Primer Name: R6-R
5' Primer Sequence: caccATGAAGGATCACGGATCGGGCGG 3' Primer Sequence: GGCCCTCCATGCATTTGCGTC
5' Primer Tm (º C): 66.24 3' Primer Tm (º C): 61.81
PCR Condition:
Nucleotide Sequence: ATGAAGGATCACGGATCGGGCGGCGTCACTCCCAGCCCCGCAGAAGGGGAAAAGAAACCCATCAACTCGGAGCTGTGGCA
CGCTTGTGCGGGGCCCCTGGTGTCGTTGCCCCCGGTGGGCAGTCTCGTCGTATACTTCCCGCAGGGCCATAGTGAACAGG
TTGCTGCTTCAATGCATAAGGAGCTGGACACCGTCCCCAGCTACCCATCTCTGCCTTCTAAGTTGATCTGCAAGCTCCTA
AGTCTCACCTTACATGCAGATTCTGAAACTGATGAAGTTTATGCCCAGATGATGCTTCAGCCTGTGAACAAATATGATCG
AGACGCAATGCTGGCATCTGAACTGGGTCTGAAACAAAACAAGCAACCAACAGAATTCTTTTGCAAGACGTTGACAGCAA
GCGACACAAGTACGCATGGGGGATTCTCAGTGCCACGCCGTGCAGCTGAGAAGATATTTCCACCGCTAGACTTTACGATG
CAACCACCAGCCCAAGAACTCATTGCCAAGGATCTGCATGATATTTCATGGAAATTTCGACATATCTATCGAGGTCAACC
GAAGAGGCATCTTTTGACAACTGGTTGGAGTGTCTTCGTCAGTACAAAAAGGCTGTTAGCCGGTGATTCAGTTCTCTTTA
TAAGGGACGAGAAATCTCAACTTCTCTTAGGTATAAGGCGTGCTAGCAGACCCCAACCAGCTCTGTCATCATCAGTTTTA
TCAAGTGACAGCATGCACATTGGAATCCTTGCAGCAGCAGCCCATGCTGCCGCAAATAGTAGCCCATTTACTATTTTCTA
TAACCCAAGGGCAAGCCCATCAGAATTTGTCATCCCTTTAGCAAAATACAATAAGGCTTTGTATACACAAGTGTCCCTTG
GAATGCGATTCAGAATGCTCTTTGAGACAGAGGATTCAGGGGTAAGAAGATACATGGGCACGATCACAGGCATTGGCGAC
TTAGATCCACTGCGATGGAAGAATTCTCATTGGCGAAACCTTCAGGTTGGTTGGGATGAATCGACTGCATCTGAGAGGCG
CACCCGTGTTTCGATATGGGAGATTGAACCAGTTGCTACACCATTTTATATATGCCCACCACCATTTTTCAGGCCAAAGC
TTCCTAAGCAAGCAGGAATGCCAGATGATGAAAACGAGGTTGAGAGTGCTTTCAAAAGAGCGATGCCATGGCTTGCTGAT
GACTTCGCTCTGAAAGATGTCCAAAATGCATTATTTCCAGGCCTGAGCCTAGTTCAATGGATGGCTATGCAGCAAAATCC
TCAGATGCTAGCAACTGCTTCCCCTGCTGTACAGTCGCAGTACTTGACCTCTAATGCACTGGGTATGCAGGATGGGATAG
GCAGTGTCAGTGAAGATCCAACAAAAAGATTGACTATGCAGGCCCAAAATATTGGCTTACCTAATTTACAGGCTGGTTCG
AAAGTGGACCACCCTGCAATTACCCCATTAGCTCAACACCAGCAACAGCCTCACCATGTATTGCAACAACAGCAGGTCCA
ACCACTGCAGCAAAGTTCTGCGATCCTACAGCAACAGCAAGCCCAGTTGTTGCAGCAAAATGCCATTCACTTGCAGCAGC
AGCAAGAACAACTCCAACGGCAACAATCACAGCCGCAGCAACAGTTCAAAGCTACTGCATGTCTTCAGTCATCGGATCAG
CACAAGCTGAAAGAGCAACAGCCTTCAGGTGGACAAGCTGCCTCACAAGTACATTTGTTAAACCAGATTTTGCAACCATC
TTCATCTCAGCTACAACAGCTGGGTTTACCCAAGTCACCTACTCAGCGCCCAGGGTTACCAAGTCTAACAACAATGGGTT
CTTTGCAGCAGTCACAATTACCTCAGACTCCACAGCCGCAACAAACAGCAGAATACCACCAGGCACTCCTACAAAGTCAA
CAACCCCAACTACAACAGCTATCACAATCAGAACTGCAGCTGCAGCTGCTTCAAAAGATTCAACAACAAAATCTGCTATC
TCAACTGAACCCACAGCATCAGTCCCAGCTGATCCAACAATTGTCTCAGAAAAGCCAGGAAATTCTCCAGCAACAAGTTC
TTCAACATCAGTTTGGTGGTGCTGATGCCATGGGTCAGCTCAAACATTTACAGCAAACACCTTTGAACCATAATACAGGA
TCCTTGCCACCCCAGCAACTTGTAAGATCACACTCAGCACTCACTGAGAGCGAAGAACCTTCCAGCTCAACAGTTCCATC
TGGCAGCCGTATCTCCCCAATAAATTCATTTAGTAGAGCAAACCAAGGAACCAGAAATTTGCCTGAGATGCCAGCAACAC
CGCACATTGAGCACTTACTTCAGGAAATTCAAAGTAAGACAGATAATCGAATCAAGAATGATATACAAGGTAGTAAGGAA
ACGGTCCATGCACCTAATCGTCATCTAGCTTCAGATCAACTTGATGCGTCATCTGCTACCTCCTTTTGCTTAGATGAGAG
CCCACGAGAAGGCTTTTCCTTTCCTCCAGTTTGTTTGGATAACAATGTTCAAGTTGATCCAAGAGAGAATTTTCTTATTG
CGGAAAATGTGGACACATTAATGCCTGACGCCCTGTTGTCAAGAGGGATGTCGTCTGGAAAGGGTATATGCAATCTACCT
TCTGGACAAAGGGATCATAGGGATGTGGAAAACGAGCTATCCTCTGCTGCATTCAGCTCCCAGTCATTTGGTGTGCCGGA
CATGTCTTTTAAGCCTGGATGTTCAAGTGATGTTGCTGTTGCTGATGGTGGAATGGCAAGCCAAGGACTGTGGAATAGTC
AAACACAGCGGATGAGAACCTTCACCAAGGTTCAAAAGCGTGGATCCGTTGGGAGATCAATTGATATAACACGGTACCGA
GGTTACGAAGATCTTCGGCATGATCTTGCATGCATGTTCGGTATTCAAGGGCAGCTTGAAGATCCCTACAGGACGGACTG
GAAGCTGGTCTATGTTGACCACGAAAATGACATCCTCCTTGTTGGCGACGACCCATGGGAGGAGTTTGTAAGCTGTGTCA
AGAGCATTAAAATATTGTCATCTGTTGAAGTACAGCAAATGAGCTTGGATGGTGACCTTGGCTGCATCCCTCAAACTCAA
GCCTGTAGTGCTTCTGATGACGCAAATGCATGGAGGGCC
TFome clones do not contain stop codon at 3'end.
Translation: MKDHGSGGVTPSPAEGEKKPINSELWHACAGPLVSLPPVGSLVVYFPQGHSEQVAASMHKELDTVPSYPSLPSKLICKLL
SLTLHADSETDEVYAQMMLQPVNKYDRDAMLASELGLKQNKQPTEFFCKTLTASDTSTHGGFSVPRRAAEKIFPPLDFTM
QPPAQELIAKDLHDISWKFRHIYRGQPKRHLLTTGWSVFVSTKRLLAGDSVLFIRDEKSQLLLGIRRASRPQPALSSSVL
SSDSMHIGILAAAAHAAANSSPFTIFYNPRASPSEFVIPLAKYNKALYTQVSLGMRFRMLFETEDSGVRRYMGTITGIGD
LDPLRWKNSHWRNLQVGWDESTASERRTRVSIWEIEPVATPFYICPPPFFRPKLPKQAGMPDDENEVESAFKRAMPWLAD
DFALKDVQNALFPGLSLVQWMAMQQNPQMLATASPAVQSQYLTSNALGMQDGIGSVSEDPTKRLTMQAQNIGLPNLQAGS
KVDHPAITPLAQHQQQPHHVLQQQQVQPLQQSSAILQQQQAQLLQQNAIHLQQQQEQLQRQQSQPQQQFKATACLQSSDQ
HKLKEQQPSGGQAASQVHLLNQILQPSSSQLQQLGLPKSPTQRPGLPSLTTMGSLQQSQLPQTPQPQQTAEYHQALLQSQ
QPQLQQLSQSELQLQLLQKIQQQNLLSQLNPQHQSQLIQQLSQKSQEILQQQVLQHQFGGADAMGQLKHLQQTPLNHNTG
SLPPQQLVRSHSALTESEEPSSSTVPSGSRISPINSFSRANQGTRNLPEMPATPHIEHLLQEIQSKTDNRIKNDIQGSKE
TVHAPNRHLASDQLDASSATSFCLDESPREGFSFPPVCLDNNVQVDPRENFLIAENVDTLMPDALLSRGMSSGKGICNLP
SGQRDHRDVENELSSAAFSSQSFGVPDMSFKPGCSSDVAVADGGMASQGLWNSQTQRMRTFTKVQKRGSVGRSIDITRYR
GYEDLRHDLACMFGIQGQLEDPYRTDWKLVYVDHENDILLVGDDPWEEFVSCVKSIKILSSVEVQQMSLDGDLGCIPQTQ
ACSASDDANAWRA
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map