TFome Information for pUT5683

TFome Name:pUT5683
Genbank Insert ID:KJ727742
Protein Name:ZmARID6
Species: Maize
TF Family: ARID
Template: RT-PCR
Corresponding TF Gene: GRMZM2G024976
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: R13-F 3' Primer Name: R13-R
5' Primer Sequence: caccATGAGCGAGCTGGTGCGG 3' Primer Sequence: TGAATCAGGTGGTGCATTATCTTTCTC
5' Primer Tm (º C): 65.15 3' Primer Tm (º C): 57.03
PCR Condition:
Nucleotide Sequence: ATGAGCGAGCTGGTGCGGGCGGCGGCTCCGGCAGCTGCGGAGGAGGAGAAGAAGGCCGTCGCGGCTGTGACTGTGGTGGC
GAAAGGAAAAGAGAAGGCGGAGGTGACGCCGACCGTGGAGGCCTCATCGGTCGGCGACAGGGGGAGGTTCGTGGCCTACC
CGTCGCGGGTGGCGGAGCACACGGACGTGGTGGCGGACGCCGCGCGCTTCAGGGCGGCGCTCGAGGGGCTGCACACGCAC
ATGGGCACCAGGCTCAAGGTGCCGATCATTGGAGGGAAAGATTTGGATCTTCATCAGCTATATAAGGAGGTCACATCACG
GGGCGGTATTGACAAGGTGAAGGCAGAGAATAGATGGAGAGAAGTGACTGCATCATTTATTTTCCCTGCCACTGCGACAA
ATGCTTCTTTTATGCTGAAGAAATACTATATGTCACTCTTATATCATTTTGAGCAGCTATACTTCTTTAGAGTGCAAGGC
TGGCATCAACAAGAAATAGATTCCAGAATGAATTCTTCCATTGAAATTAAAACCGAAGGCCAAGCTTACCACAAAAGAAA
AAGGGGCATCAACACATCTTCAGATCCAGCTTCGTCTTCAGATAATGTTGACGTAGATGTGATAGTTGATGGCAAATTTG
AACATGGCTACATAGTGACTGTTATTATGGGATCGAAATCCACTAAAGCAATCCTCTATAATTGCACTGAAGAACCTGCT
TTGCCAACTCCGGAGCCACCTGTTGCAAATAACAGCACTGGTTTGAAGGGTGTACGTCGCCGAAGACGACGTAGGAAGAA
GCTAAGTACAACGGATCCCAGGCACCCCAAACCAAACAGGAGTGGCTATAATTTCTTCTTCCAGGATCAACATAGAATTC
TTAAGCCACAATATCCTGCACAAGACAGACTGATCAGTAAAATGATTGGTGAACGATGGAACAATCTAAGTCCTGAAGAT
AAAGCTGTATATCAGCAAAGAGGTGTAGAGGATAAGGAGCGATACCGGACCCAGTTGGCTGCTTATAAAGAACTGAGGAC
AGGCCAACCTATCAGCAATGCTGTGCCTATCCAACAGAGGCTCCCTCTGACAGAAGTGACGATTGATGAAGTAGACTCCA
AGGTGAGCCAAGATGATATGCTGCTGTCAAACCAAGGGTACAGCAGTAGTGATGAAAGTGACCATTCAGGAGAGAAAAAT
GTAGAAGACGAGCTCAACACTGAAACATCCCCTGAGGTGAGCATGGAAACAACTGGTTCTCCTGGACACCCTGATCCCTC
TCGAGATGGGGACCACTTTGAGTTGCGGCGGAGAGAAAACCCCAAGGCAGATGAGAAAGATAATGCACCACCTGATTCA

TFome clones do not contain stop codon at 3'end.
Translation: MSELVRAAAPAAAEEEKKAVAAVTVVAKGKEKAEVTPTVEASSVGDRGRFVAYPSRVAEHTDVVADAARFRAALEGLHTH
MGTRLKVPIIGGKDLDLHQLYKEVTSRGGIDKVKAENRWREVTASFIFPATATNASFMLKKYYMSLLYHFEQLYFFRVQG
WHQQEIDSRMNSSIEIKTEGQAYHKRKRGINTSSDPASSSDNVDVDVIVDGKFEHGYIVTVIMGSKSTKAILYNCTEEPA
LPTPEPPVANNSTGLKGVRRRRRRRKKLSTTDPRHPKPNRSGYNFFFQDQHRILKPQYPAQDRLISKMIGERWNNLSPED
KAVYQQRGVEDKERYRTQLAAYKELRTGQPISNAVPIQQRLPLTEVTIDEVDSKVSQDDMLLSNQGYSSSDESDHSGEKN
VEDELNTETSPEVSMETTGSPGHPDPSRDGDHFELRRRENPKADEKDNAPPDS
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map