TFome Information for pUT5684

TFome Name:pUT5684
Genbank Insert ID:KJ727743
Protein Name:ZmARID8
Species: Maize
TF Family: ARID
Template: RT-PCR
Corresponding TF Gene: GRMZM2G180654
Transcript: T05
Vector: pENTR/SD/D-TOPO

5' Primer Name: R15-F 3' Primer Name: R15-R
5' Primer Sequence: caccATGTCGCAACAGCAAGGTGTGGAGG 3' Primer Sequence: TTTTGATTGTTCAAATGGTGCACGCAC
5' Primer Tm (º C): 66.23 3' Primer Tm (º C): 59.26
PCR Condition:
Nucleotide Sequence: ATGTCGCAACAGCAAGGTGTGGAGGAGCCGCCGCCGGCACCGCTGCCGGCGGCGGAAGGCGAGGCACAACCGGCCGCCGA
TATCCCCATGAGCGAGGCCGCGGAGGTGGAGGATGAGGAGGAGGAACCCGTCGTGGGGGAGGGGGAGGACGGTGCAGACG
GGGCCGCCGACGCCGTCGATTCCGTCAATGCTTCAGCGAAACCCGAAGCAGAGGGCGCGGAGGAGGAGGGGGGCAGCGAC
AGGAAGGAGCGGAATGGTGGCCCGACGGCGGATTTGGTTGGCGAGGTTGTGAAGTTGGAGAATGGGGACGGGCCTGTGAC
GGTGGGCGGCTCGGTGGACGAGGGTCGAGGTGGAGATGGCGGTGACGACAAAGGCCTGGCTGGTCAGAATCAGCCTGCTG
TGAACCAGCTTTTGCTGGCGCCGGCTGAGGAGGATCTGGCATTGTCCAAGATCTCAGATAATTCCTTCATGTTCGATTAC
ACCACTGGTGGCGATGACTCGGGGACTGAGGAGGAGCAGGCTGCCTTCATGAAGGAGCTCGAGCGTTTCCACAGGGAGAA
AATGTTGGAGTTCAAGCCTCCGAAGTTTTATGGCGAAGGATTGAATTGCCTCAAATTGTGGAGACAAGTTACTGGATTGG
GTGGCTATGATCAGGTGACATCATGCAAGCTGTGGCGTCAAGTAGGAGAGTCATTCAAACCTCCAAAGACATGCACAACT
GTTTCATGGACTTTCCGTAACTTCTATGAGAAGGCACTCCTTGAATACGAGAAACACAAAATCGAAACAGGAGAGTTCCA
AGTAGCTTCATCTGCTCTACCAGACCGGTTTGGTTCTGAGAGTCAGGTGGGTGGAAGCCATGTATCTGGTTCTGGAAGAG
CCAGAAGAGAATCTGCAACTCGTGCAATGCAAGGTTGGCATTCTCAGCGCCTACTAGGGAATGGTGAAATCGCTGACCCT
ATAATTAAGGATAAAGGGCATATTGTCTTAAAGAAGGATAAAACTCCTAAAAGCAGTGGTTCTGCCAAGAGGAAAAGGAC
ACTATCCCTGGAAGATGACAGGGTGATACCTTATAAATCTGATCAGCTACAAAATGACTCGATGGTTATTGACATGGGCC
CCCCTGCTGATTGGGTGAAAATAAATGTTAGGAAAACTAAAGATTGCTATGAAGTCTATGCGTTGGTTCCTGGCCTTCTG
AGGGAAGAGGTACATGTTCAGTCCGACCCAGCTGGTCGTTTGATAGTTACTGGAGAGCCTGAGCAATTGGATAACCCATG
GGGTGTCACTCCATTCAAGAAGGTCATTAGTTTGCCTTCCCGCATTGACCCTCACCAAACCTCCGCAGTTGTCACCCTCC
ATGGGCAGCTATTTGTGCGTGCACCATTTGAACAATCAAAA
TFome clones do not contain stop codon at 3'end.
Translation: MSQQQGVEEPPPAPLPAAEGEAQPAADIPMSEAAEVEDEEEEPVVGEGEDGADGAADAVDSVNASAKPEAEGAEEEGGSD
RKERNGGPTADLVGEVVKLENGDGPVTVGGSVDEGRGGDGGDDKGLAGQNQPAVNQLLLAPAEEDLALSKISDNSFMFDY
TTGGDDSGTEEEQAAFMKELERFHREKMLEFKPPKFYGEGLNCLKLWRQVTGLGGYDQVTSCKLWRQVGESFKPPKTCTT
VSWTFRNFYEKALLEYEKHKIETGEFQVASSALPDRFGSESQVGGSHVSGSGRARRESATRAMQGWHSQRLLGNGEIADP
IIKDKGHIVLKKDKTPKSSGSAKRKRTLSLEDDRVIPYKSDQLQNDSMVIDMGPPADWVKINVRKTKDCYEVYALVPGLL
REEVHVQSDPAGRLIVTGEPEQLDNPWGVTPFKKVISLPSRIDPHQTSAVVTLHGQLFVRAPFEQSK
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map