TFome Information for pUT5686

TFome Name:pUT5686
Genbank Insert ID:KJ727745
Protein Name:ZmbHLH73
Species: Maize
TF Family: bHLH
Template: RT-PCR
Corresponding TF Gene: GRMZM2G008898
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: R18-F 3' Primer Name: R18-R
5' Primer Sequence: caccATGGATCCCGCCTCGTCGGTG 3' Primer Sequence: TGTCACTCTTTCATATGCGTTGCCGAC
5' Primer Tm (º C): 67.06 3' Primer Tm (º C): 60.95
PCR Condition:
Nucleotide Sequence: ATGGATCCCGCCTCGTCGGTGGCCGCCGAGTTTTGGCGGCCGCCGTACCACCACCTCCGGGCCTCGTCCGTCGTCACCGC
CGCCGCCCGCTCCGGGGGCGGCTCCAGCAGCCGCAGGAGACCGCGGCGCGACGCCGCGGCGTCGTCCGAGGAGGAGCCGT
CCAAGCTCGTTTCCACGTCGGGCACCGCCGCCAGCAGCAGCGCGGGCTGCCAGGACTCGGCTGACCCAGAAGCAAAACGG
TTGAAACAGATAGCACCTAGTGAAAAAAATGACAGAAGGACAGAAGCTGAAACAAATTCAGGGAACGCTAGCAAGTCTGC
TGATAAAAAGCCTGCACCTAAAGAGCCACCAAAAGACTACATCCATGTGAGGGCTAGAAGAGGTCAAGCAACGGACAGCC
ATAGCCTCGCAGAAAGAGCACGACGAGAGAAGATAAGTGAACGGATGAAAGTTCTTCAAGATATTGTCCCTGGATGCAAC
AAGGTTATCGGGAAAGCATCAGTCCTTGATGAGATAATAAATTACATCCAGTCTTTACAGCGTCAAGTAGAGTTTTTGTC
CATGAAACTTGAAGCGATTAATGCTCATGTGAGCAATGCAACTGTAGCTTTTCCAACCAAAGATTTTGGTGTTGCGCCAT
ATAATACTGCTCCTAGCCTGACGTTGGACCCACAAACGCCAAGGGAATACGCCCAGGGCTCGATGTCAGATTGGCTTCAC
ATGCAGGTCGGCAACGCATATGAAAGAGTGACA
TFome clones do not contain stop codon at 3'end.
Translation: MDPASSVAAEFWRPPYHHLRASSVVTAAARSGGGSSSRRRPRRDAAASSEEEPSKLVSTSGTAASSSAGCQDSADPEAKR
LKQIAPSEKNDRRTEAETNSGNASKSADKKPAPKEPPKDYIHVRARRGQATDSHSLAERARREKISERMKVLQDIVPGCN
KVIGKASVLDEIINYIQSLQRQVEFLSMKLEAINAHVSNATVAFPTKDFGVAPYNTAPSLTLDPQTPREYAQGSMSDWLH
MQVGNAYERVT
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map