TFome Information for pUT5687

TFome Name:pUT5687
Genbank Insert ID:KJ727746
Protein Name:ZmbHLH157
Species: Maize
TF Family: bHLH
Template: RT-PCR
Corresponding TF Gene: GRMZM2G009478
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: exon 3 (291 bp = 97 aa) skipped and intron 7 retained. Protein is truncated within exon 7. Support in RNA-seq

5' Primer Name: R19-F 3' Primer Name: R19-R
5' Primer Sequence: caccATGGGCATCCAAGGGAACAAGG 3' Primer Sequence: GCTGTTGTCCCGTTTATGCCGTTTC
5' Primer Tm (º C): 63.75 3' Primer Tm (º C): 60.75
PCR Condition:
Nucleotide Sequence: ATGGGCATCCAAGGGAACAAGGCGGCGACGCACGAGCACGACTTCCTCTCGTTGTACGCCGCCGCCGCCGCGGCCGCCGC
CGCCAAGGACGCTCCTCTCCTGCTCCACGACTCCAAGACGCCGCCTCCTTCTCAAGGGCACCAGCAGCAGTGGGCGCTCC
CCTTCGCCGGCTCCTTGCAGGTCAGTCCGCCGCCGCAGCAGGCGCAACCGGATAGGAAGGGCCGCGGCGGAGGCGGGGTC
ATGGATTCAGGCTCCAGATCCAGCGGCGGAGCCGGGTTCGACGACGAAGACGGCCTCACCACGCGCCGCGAGGTCTCCTC
CTCGCTCCAAGATTTGGCAGTAAGGGTGGATTGGAAGGGTGGGAGCTGCAGCGATGGCGGTACAAATCAGGGGCCAAACA
CACCACGGTCAAAACACTCGGCCACAGAGCAGCGCAGACGCAGCAAGATCAATGATAGGTTTCAGATACTTAGGGAGCTG
TTGCCACACAATGATCAAAAGAGAGACAAAGCAACATTTCTCTTGGAGGTTATTGAATATATACGTTTTTTGCAAGAGAA
AGCGCAAAAATACGAGGCAACATTCCCAGAATGGAACCAAGAAAATCCAACGATGCTTCCGTGGGTAATTGCTTCTTTAT
CGAAAGCTGCAATGCTTGCTACTGCCGTTAGGAAAGGAACAGTCAATTCATGATTGTCTGTGTCTGAATGTAGTTTTACA
TTCTTGCAGTCAAATATGTATTTTCGATCATTCTGGAAAAATGCACAGGCAAGTGTTTGTTGCTAAAAAATGCATTTGCC
TTGCCGGGTCGATAATGCTGTGTCAATAGTTTTGAACCATCATCTTAGGCATGCTTGTTATTCTTGTGCTGCAGAGTAAA
GGCCAAATCCCAGGAGATTCCCCGCCTGACCCTTCACATTTCGTGAGAAATGGATCCTCCCCTGGATCTAATTTCACTGG
GAAACTCGATGATAATCACACATCTGCAGCTGCATCAGGGGCACTGGACCAGGCAGAAACTAATCACGTGGCTAGCGGCT
GCTACAGATCATCAGAAACTCCGGCGAATATTACAAATAATGCTATATCTCAGTCCCAACCTCAATGGACAGGTCCGTCC
CCTGTGGATGACTCTGCAGTGAAAAGTGAAATGCTTAACAGCCAGGAGTTGGCAATAGATGAAGGAATGATCAGTGTGTC
CAGTACCTATTCCCAAGAGTTACTTATCTCGTTGTCTCACGCCCTTCAGAGCTCAGGTGTGGATCTGTCCCAAACCAGCA
TCTCTGTGCAGATCAACCTGGGAAAGCGTGCTGGCAAGAGATCTGCATCTGCTGGTGGTGTATCCTCCAACTCCAAGGAA
CCACCAGCCGATCCAGCATCTAGTAACGAACTAGGCGGCCATCACGTGACAACGTTGGGAGCTAGCGCTGACGGTCTCCT
CCCCCACGCGACGAAACGGCATAAACGGGACAACAGC
TFome clones do not contain stop codon at 3'end.
Translation: MGIQGNKAATHEHDFLSLYAAAAAAAAAKDAPLLLHDSKTPPPSQGHQQQWALPFAGSLQVSPPPQQAQPDRKGRGGGGV
MDSGSRSSGGAGFDDEDGLTTRREVSSSLQDLAVRVDWKGGSCSDGGTNQGPNTPRSKHSATEQRRRSKINDRFQILREL
LPHNDQKRDKATFLLEVIEYIRFLQEKAQKYEATFPEWNQENPTMLPWVIASLSKAAMLATAVRKGTVNS*LSVSECSFT
FLQSNMYFRSFWKNAQASVCC*KMHLPCRVDNAVSIVLNHHLRHACYSCAAE*RPNPRRFPA*PFTFREKWILPWI*FHW
ETR**SHICSCIRGTGPGRN*SRG*RLLQIIRNSGEYYK*CYISVPTSMDRSVPCG*LCSEK*NA*QPGVGNR*RNDQCV
QYLFPRVTYLVVSRPSELRCGSVPNQHLCADQPGKACWQEICICWWCILQLQGTTSRSSI**RTRRPSRDNVGS*R*RSP
PPRDETA*TGQQ
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map