TFome Information for pUT5690

TFome Name:pUT5690
Genbank Insert ID:KJ727749
Protein Name:ZmbHLH148
Species: Maize
TF Family: bHLH
Template: RT-PCR
Corresponding TF Gene: GRMZM2G080054
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: R28-F 3' Primer Name: R28-R
5' Primer Sequence: caccATGGAAGATGGCAGTGCTCCAAGAC 3' Primer Sequence: CTCCATGAAGTTATACGAGGAACTCCCAG
5' Primer Tm (º C): 64.25 3' Primer Tm (º C): 59.59
PCR Condition:
Nucleotide Sequence: ATGTACGGCTCGCCGGTGTCCAAGGACCTCAACCTCCCGGTGCAGCCGCCCATGGCCTCGTCCGGGCTGCTGAGGTACAG
ATCGGCGCCCAGCACGGTGCTCGGCGACCTGTGCGAGGACTTCCTCTCTTCCGCGCCCCGCGCCGCCAGCCCTGACGCCG
GCGCCGACAACGTCTTCTCCAGGTTCCTTGCTGACCACCACATCCGGGACGACAAGCCGTCGCCGCTTGCCTCCGCCGCC
GTCCACTTCCCGACTGAAACCGACACGGCCTCCCAGCAGCAGCAGCAGCAGATGATGTTCCACTCCCAGCAGCAGCAGGA
GATGGTGAGCGCCAAGTCCGGCCTTTACCGCACCGTGAACTCAGGCGTAGAAACCGCGGCCGCTGCTGGTGCCGGCGGGG
CCAGCTCCAGTGACAACGCTAGCAACCTGATTCGACAGAGCAGCTCCCCCGCCGGATTCCTCGATCATTTGAACATGGAG
AACGGATACGGGGCCATGCTGAGGGCGGGCATGGCCACGGCGGACTCCCTCGCAGGCGGCGGCAGCAGGCTAAAAGGGCA
ACTGAGCTTCTCGTCACGGCAGGGGTCATTGATGTCCCAGATCTCAGAGATGGACAGCGAGGAGGTCGGAGGGAGCAGCC
CAGAGGCTTCCGGCGGCGGCGGCAGGGGGTACATCCCTGGGTACCCAATGGGCTCTGGGTGGGAGGACTCGTCGGCTCTC
TTGTCAGACAATTTGTCTGGCGTCAAACGCCCCCGGGACTCGTCGGAGCCTGGCCAGAGCGGCCTTACGCACCAGTTCAG
CGTGCCCAAGACGTCGTCCGAGATGGCAACTATTGAGAAATTCCTCCAGTTCCAGGACGCCGTGCCTTGTAAGATCCGTG
CCAAGCGGGGGTGCGCCACTCATCCACGCAGCATCGCTGAGAGGGTGAGGAGAACAAAGATCAGTGAGCGAATCCGAAAG
CTGCAAGAACTCGTTCCAAATATGGACAAGCAAACCAACACATCTGACATGCTGGATTTGGCTGTCGACTACATCAAGGA
TCTCCAGAAGCAGGTTAAGGTACTAAAGGAGAGCCAAGATAACTGCACCTGCTCAGCAAGCAAGAACCAGCAGCACTCCT
GC
TFome clones do not contain stop codon at 3'end.
Translation: MYGSPVSKDLNLPVQPPMASSGLLRYRSAPSTVLGDLCEDFLSSAPRAASPDAGADNVFSRFLADHHIRDDKPSPLASAA
VHFPTETDTASQQQQQQMMFHSQQQQEMVSAKSGLYRTVNSGVETAAAAGAGGASSSDNASNLIRQSSSPAGFLDHLNME
NGYGAMLRAGMATADSLAGGGSRLKGQLSFSSRQGSLMSQISEMDSEEVGGSSPEASGGGGRGYIPGYPMGSGWEDSSAL
LSDNLSGVKRPRDSSEPGQSGLTHQFSVPKTSSEMATIEKFLQFQDAVPCKIRAKRGCATHPRSIAERVRRTKISERIRK
LQELVPNMDKQTNTSDMLDLAVDYIKDLQKQVKVLKESQDNCTCSASKNQQHSC
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map