TFome Information for pUT5692

TFome Name:pUT5692
Genbank Insert ID:KJ727751
Protein Name:ZmbHLH83
Species: Maize
TF Family: bHLH
Template: RT-PCR
Corresponding TF Gene: GRMZM2G169947
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: R35-F 3' Primer Name: R35-R
5' Primer Sequence: caccATGGAGATGAGAGCGAAGAAGAGCAG 3' Primer Sequence: CCTACGTACGTACGTACGTACCTTGCAG
5' Primer Tm (º C): 63.16 3' Primer Tm (º C): 61.28
PCR Condition:
Nucleotide Sequence: ATGGAGATGAGAGCGAAGAAGAGCAGCAGAAGCAGCACGAGCAACACCAGCGGCAGCACGACGACCACGGCGGTGGAGAG
GAAGGAGATCGAGAGGAGGAGGAGGCAGCAGATGAAGAGCCTCTGCGCCAAGCTCGCCTCCCTCATCCCGAAAGAACACT
ACTCCTCCAAGGATGCTATGACCCAGCTGGGTAGCCTAGACGAGGCAGCCACGTACATAAAGAGACTCAAGGAGAGGGTG
GAGGAGCTGCGGCACAAGAGCGCCTCTGCACGGCTCTTGGCCGCTGGCAGTGGCACGAGACGAGGCGGAGGAGGAGGAGG
CGCCTCCACATCGTCGGCAGCGACGACCACGGCGAGCGGTGGCGCAGGATCATCTGAAGAAGCCGGCCGGCGGGAGGACG
ACATGCCGCCGGCGGTGGTAGAGGTTCGGCAGCACAATGACGGGTCAAGCCTGGACGTGGTGCTCATCAGCAGCGCGGCG
CGACCCTTCAAGCTGCACGAGGTGGTCACCGTGCTGGAGGAAGAAGGCGCCGAGACCGTCAACGCCAACCTCTCCGTCGC
CGGCACCAAAATCTTCTACACCATCCACTGCAAGGTACGTACGTACGTACGT
TFome clones do not contain stop codon at 3'end.
Translation: MEMRAKKSSRSSTSNTSGSTTTTAVERKEIERRRRQQMKSLCAKLASLIPKEHYSSKDAMTQLGSLDEAATYIKRLKERV
EELRHKSASARLLAAGSGTRRGGGGGGASTSSAATTTASGGAGSSEEAGRREDDMPPAVVEVRQHNDGSSLDVVLISSAA
RPFKLHEVVTVLEEEGAETVNANLSVAGTKIFYTIHCKVRTYVR
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map