TFome Information for pUT5757

TFome Name:pUT5757
Genbank Insert ID:KJ727805
Protein Name:ZmbZIP52
Species: Maize
TF Family: bZIP
Template: BT066852.1
Corresponding TF Gene: GRMZM2G174284
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.T312C p.S104(=) c.T507C p.G169(=) PZE0151844017 c.C717G p.G239(=) PZE0151843245 c.C969T p.S323(=) PZE0151842834 All SNPs present in FlcDNA.

5' Primer Name: B468_F 3' Primer Name: B468_R
5' Primer Sequence: caccATGGCAGATGCTAGTTCGAGG 3' Primer Sequence: CTCTCGCGGCCTAGCGAGC
5' Primer Tm (º C): 67.5 3' Primer Tm (º C): 67.8
PCR Condition: 5 l GC buffer (Thermo Fisher?Finnzymes: contains 1.5 MgCl2)) 1 l primer forward 20mM 1 l primer reverse 20mM 5 l glycerol 50% 1 l DNA template (c=1 ng/l) 1 l dNTPs 10mM 0.25 l phusion taq (NEB) 10.75 l ultrapure water PCR program: 40 sec 98°C 30x : 15 sec 98°C 30 sec 58°C 40 sec 72°C 7 min 72°C leave at 4°C
Nucleotide Sequence: ATGGCAGATGCTAGTTCGAGGACTGACACCTCGACTGTTTTAGACATGGATGATAAGAATCAAAGGTTAGAAAATGGACA
GAGTGGAGCTATGGCCCTGGCTTCGAATTCATCTGATCGGTCTGACAGATCTGACAAACCTATGGACCAAAAGGTTTTAC
GACGGCTTGCCCAAAATCGTGAGGCAGCAAGGAAAAGTCGGCTGAGGAAAAAGGCATATGTGCAACAACTAGAGAGCAGC
AAGCTAAAACTTGCAAGCCTGGAGCAAGAACTCCAGAAAGCTCGACAACAGGGAATCTTCATATCCAGTTCCGGAGATCA
AACTCATGCTATGAGTGGAAATGGAGCTATGACCTTCGATTTAGAATATTCTCGATGGCAAGAGGAAGAAAATAAGCAGA
TAAATGAGCTGAGGACTGCAGTAAATGCTCATGCAAGTGAAAGTGACCTCCGTCTTATCGTCGATGGGATAATGGCACAT
TATGATGAGATATTCAGGCTGAAGGGCATTGCTGCAAAGGCTGATGTGTTCCATATACTTTCAGGCATGTGGAAAACACC
TGCTGAAAGGTGCTTCTTGTGGCTTGGGGGTTTCCGTTCGTCTGAGCTTCTAAAGCTCCTTGTGAATCAGCTTGAGCCTC
TAACTGAGCAGCAATTGATGGGGCTATCCAATCTCCAGCAATCCTCCCAGCAGGCTGAGGATGCATTGTCACAAGGGATG
GAAGCATTGCAGCAATCCTTGGCAGAAACGCTGGCTGGGTCCCTTGGTCCATCAGGATCTTCCGGAAACGTCGCAAACTA
TATGGGTCAAATGGCTATGGCCATGGGAAAACTTGGCACACTCGAGAATTTCCTTCGTCAGGCTGACAATCTACGACAGC
AGACCTTGCATCAGATGCAACGCATCCTGACAATTCGACAAGCCGCTCGCGCGCTTCTTGCAATACACGACTACTTTTCA
CGTCTACGTGCCCTGAGTTCTCTTTGGCTCGCTAGGCCGCGAGAG
TFome clones do not contain stop codon at 3'end.
Translation: MADASSRTDTSTVLDMDDKNQRLENGQSGAMALASNSSDRSDRSDKPMDQKVLRRLAQNREAARKSRLRKKAYVQQLESS
KLKLASLEQELQKARQQGIFISSSGDQTHAMSGNGAMTFDLEYSRWQEEENKQINELRTAVNAHASESDLRLIVDGIMAH
YDEIFRLKGIAAKADVFHILSGMWKTPAERCFLWLGGFRSSELLKLLVNQLEPLTEQQLMGLSNLQQSSQQAEDALSQGM
EALQQSLAETLAGSLGPSGSSGNVANYMGQMAMAMGKLGTLENFLRQADNLRQQTLHQMQRILTIRQAARALLAIHDYFS
RLRALSSLWLARPRE
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map