TFome Information for pUT5779

TFome Name:pUT5779
Genbank Insert ID:KJ727826
Protein Name:ZmALF12
Species: Maize
TF Family: Alfin-like
Template: BT061636.1
Corresponding TF Gene: GRMZM5G893976
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.G31T p.V11F SNP not present in template FLcDNA, not in functional domain.

5' Primer Name: B409_F 3' Primer Name: B409_R
5' Primer Sequence: caccATGGCGGACGCCGCCTCT 3' Primer Sequence: CTGCCTCGCCCTCTTGGAGCTGCAG
5' Primer Tm (º C): 73.7 3' Primer Tm (º C): 67.3
PCR Condition: PCR Conditions: Volumes per reaction (25l): 5 l GC buffer (Thermo Fisher) 1 l primer forward 20M 1 l primer reverse 20M 5 l glycerol 50% 1 l 1 ng/l DNA template 1 l MgCl2 50mM 1 l dNTPs 10mM 0.25 l phusion taq (Thermo Fisher) 9.75 l ultrapure water PCR program 40 sec 98°C 35x : 15 sec 98°C 30 sec 60°C 40 sec 72°C 7 min 72°C leave at 10°C
Nucleotide Sequence: ATGGCGGACGCCGCCTCTGGCCGCGGCCACTTCGTCTACCCTCCCCGCTCCGCCGAGGACATCTTCAAGGACTACCGCGC
CCGCCGGTCCGCCATCCTCCGCGCCCTCACTCACGAGGTCGAGGACTTCTACGCGCAGTGCGATCCAGACAAGGAGAACC
TGTGCCTGTACGGCTACGCGAACGAGGCGTGGGAGGTGGCGCTGCCGGCAGAGGAGGTGCCCACGGAGCTGCCGGAGCCT
GCGCTGGGAATCAACTTCGCGCGCGACGGAATGAACCGCCGGGACTGGCTTGCGCTCGTCGCCGTCCACTCCGACTCGTG
GCTCCTCTCCGTCGCCTTTTACTATGCCGCTCGGCTTAATCGTAATGACCGGAAGCGCTTATTTGGTATGATTAATGAAT
TGCAAACTGTTTTTGAAGTTGTCTCCGGTGCGAGACAACAACAATCTAAAGAGAGGTCCAGTATGGACAATGGTGGTAGA
GCCAAGCCTGTAAAGATAGAAAATAATGGAAAAGTCACAGACGAAGCATACGAAGATGACAGTGATCACGGTGAAACCCT
ATGTGGAACCTGTGGTGGGATATACAACGCGGATGAGTTTTGGATCGGGTGTGACATGTGCGAGCGATGGTACCATGGCA
AGTGTGTCAAGATAACTCCTGCCAAGGCAGAGAGCATAAAGCATTACAAATGCCCGAGCTGCAGCTCCAAGAGGGCGAGG
CAG
TFome clones do not contain stop codon at 3'end.
Translation: MADAASGRGHFVYPPRSAEDIFKDYRARRSAILRALTHEVEDFYAQCDPDKENLCLYGYANEAWEVALPAEEVPTELPEP
ALGINFARDGMNRRDWLALVAVHSDSWLLSVAFYYAARLNRNDRKRLFGMINELQTVFEVVSGARQQQSKERSSMDNGGR
AKPVKIENNGKVTDEAYEDDSDHGETLCGTCGGIYNADEFWIGCDMCERWYHGKCVKITPAKAESIKHYKCPSCSSKRAR
Q
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map