TFome Information for pUT5886

TFome Name:pUT5886
Genbank Insert ID:KJ727842
Protein Name:ZmCOL11
Species: Maize
TF Family: C2C2-CO-like
Template: RT-PCR
Corresponding TF Gene: GRMZM2G095598
Transcript: T01
Vector: pENTR/SD/D-TOPO
Note: c.G290A p.R97H. Not in template FlcDNA. Not in functional domain.

5' Primer Name: R172F 3' Primer Name: R172R
5' Primer Sequence: caccATGGAGGGTGACGAGAAGTCGGC 3' Primer Sequence: ATATGTGGGCACGACGCCGTAGT
5' Primer Tm (º C): 65.9 3' Primer Tm (º C): 62.6
PCR Condition:
Nucleotide Sequence: ATGGAGGGTGACGAGAAGTCGGCGGGCGGGGCCCCTGCTTACTGGGGCCTGGGCGCGCGGCCCTGCGACGCGTGCGGCGC
CGAGGCGGCGCGCCTCTACTGCCGCGCGGACGCGGCGTTCCTGTGCGCCGGGTGCGACGCGCGGGCGCACGGCGCCGGGT
CGCGCCACGCGCGGGTCTGGCTCTGCGAGGTCTGCGAGCACGCGCCGGCGGCGGTCACGTGCCGCGCGGACGCTGCCGCG
CTCTGCGCCTCCTGCGACGCCGACATCCACTCGGCGAACCCGCTCGCGCACCGCCACGAGCGCCTCCACGTGGCGCCCTT
CTTCGGCGCGCTGGCCGACGCGCCCAAGCCCTTCGCCTCGGCGGCGCCGCCCAAAGCAACCGACGACGACGGGAGCAACG
AGGACGAGGCGGCGTCGTGGCTCCTCCCCGAGCCCGACCACGGGCAGAAAGAAGGCGCCACGACGGAGGTGTTCTTCGCG
GACTCTGACCCGTACCTCGACCTCGACTTCGCGCGTTCCATGGACGAAATCAAGACCATCGGCGTCCAGCAGAGCGGGTC
ACCAGAGCTCGACCTCGCCGGCACCAAGCTCTTCTACTCCGATCACTCCGTGAACCACAGTGTGTCATCGTCGGAGGCAG
CGGTTGTGCCCGACGCGGCGTCTGGCATGGCGCCCATGGTGGCAGTGGTCAGCAGGGGCCTGGAGCGAGAGGCGCGGCTG
ATGCGGTACCGGGAGAAGCGCAAGAGCAGGCGGTTCGAGAAGACGATCCGGTACGCGTCCCGCAAGGCGTACGCGGAGAC
GCGGCCGCGCATCAAGGGCCGGTTCGCCAAGCGCACGCCCGGGGCTGGGGAGGACACGCTGGAGGAGCACGAGGAGATGT
ACTCCTCCGCCGCTGCCGCCGTGGCTGCGCTCATGGCCCCCGGCGGAGCCGATGCGGACTACGGCGTCGTGCCCACATAT

TFome clones do not contain stop codon at 3'end.
Translation: MEGDEKSAGGAPAYWGLGARPCDACGAEAARLYCRADAAFLCAGCDARAHGAGSRHARVWLCEVCEHAPAAVTCRADAAA
LCASCDADIHSANPLAHRHERLHVAPFFGALADAPKPFASAAPPKATDDDGSNEDEAASWLLPEPDHGQKEGATTEVFFA
DSDPYLDLDFARSMDEIKTIGVQQSGSPELDLAGTKLFYSDHSVNHSVSSSEAAVVPDAASGMAPMVAVVSRGLEREARL
MRYREKRKSRRFEKTIRYASRKAYAETRPRIKGRFAKRTPGAGEDTLEEHEEMYSSAAAAVAALMAPGGADADYGVVPTY
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map