TFome Information for pUT5887

TFome Name:pUT5887
Genbank Insert ID:KJ727843
Protein Name:ZmCOL8
Species: Maize
TF Family: C2C2-CO-like
Template: RT-PCR
Corresponding TF Gene: GRMZM2G114137
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: R174F 3' Primer Name: R174R
5' Primer Sequence: caccATGACGAGCGCCGGAGCG 3' Primer Sequence: AAACCACAAGCGCCCGTTCG
5' Primer Tm (º C): 67.2 3' Primer Tm (º C): 61.4
PCR Condition:
Nucleotide Sequence: ATGACGAGCGCCGGAGCGGCGACAGGCGCCGCGCTAGGCGCGCGGACGGCGCGGTCCTGCGACGGCTGCATGAGGCGGCG
GGCGCGGTGGCACTGCCCCGCCGACGACGCCTTCTTGTGCCAGACCTGCGACGTCTCCGTGCACTCGGCGAACCCGCTCG
CGCGCCGCCACCACCGCGTCCGCCTCCCCTCTGCGTCCTGCTCCTCCCCACCGCGCGACCCGGACGCGCCAACGTGGCTC
CACGGCCTCAAGCGACGGCCACGCACGCCGCGGTCCAAGCCAGGGGGGAGCAAGAGCAACAAGCATGAGGCGACTCCCAG
CTTTATCGCCGCGGCTGCGTCGTCGGCAGCGGTCCCCGACCTCGAGGCGGAGGAGTCCGGCTCCGGTATCCTGGGCGGTA
ACGACGACCACCACGGGTTCCTGCAGGATGACGACGAAGACCTTCTGTACCGCGTGCCGGTGTTCGACCCTATGCTCGCC
GAGTTCTACAACCCCGTGGCCGACGAGGGGGAGCAGAAGCCGGCCTGCAGCCTGCTGATGCCGTCTCTCGCGGAAACATC
GCCGGAGTTCGCCTCCGGCGGCTCGGCGGAGGCGGACGGGCTCTCCGTGTCGTTCCACGTCCCGGACATGGAGCTCGCTA
GCTTCGCCGCGGACATGGAGAGCCTCCTCATGGGAGTCGACGACGACGGGTTTGACTGTTTGGGTTTCTTGGACGAAGAG
AAACCTCAGGTGAACGCGGACTTGGACGCCATAGTAGCGCCGGCGCCTGAACCAGAGGACAAGAAACGGAAGCGGCCGGA
GATGATACTCAAGCTCAACTACGAAGGCGTCATCGCCTCATGGGTCCGTGACGGCGGCTCGCCGTGGTTCCACGGCGAGC
GTCCTCACCTCGACTGTCACGAGCTATGGTCGGACGACTTCACGACGGGTAGCCGGGAACTCCTCGGCGGAGCCGTGACA
CCGGTGACCGGTGGCGAGCGTGAGGCGCGGGTGTCGCGATACAGGGAGAAGCGGCGGACGCGACTGTTCGCCAAGAAGAT
CCGGTACGAGGTGCGCAAGCTCAACGCCGAGAAGCGGCCGCGGATGAAGGGTCGGTTCGTGAAGCGCGCCACGCTTCCGC
CGCTGCCAAGGCCGCCGCCGCCGCAGCAGCAGCAGCAGCAGAAGCAGCTGCCACGCGCACCGCCACACGTGGGCATGGTG
CTCCCACCACCTCCGGTATCGAACGGGCGCTTGTGGTTT
TFome clones do not contain stop codon at 3'end.
Translation: MTSAGAATGAALGARTARSCDGCMRRRARWHCPADDAFLCQTCDVSVHSANPLARRHHRVRLPSASCSSPPRDPDAPTWL
HGLKRRPRTPRSKPGGSKSNKHEATPSFIAAAASSAAVPDLEAEESGSGILGGNDDHHGFLQDDDEDLLYRVPVFDPMLA
EFYNPVADEGEQKPACSLLMPSLAETSPEFASGGSAEADGLSVSFHVPDMELASFAADMESLLMGVDDDGFDCLGFLDEE
KPQVNADLDAIVAPAPEPEDKKRKRPEMILKLNYEGVIASWVRDGGSPWFHGERPHLDCHELWSDDFTTGSRELLGGAVT
PVTGGEREARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRATLPPLPRPPPPQQQQQQKQLPRAPPHVGMV
LPPPPVSNGRLWF
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map