TFome Information for pUT5888

TFome Name:pUT5888
Genbank Insert ID:KJ727844
Protein Name:ZmCOL2
Species: Maize
TF Family: C2C2-CO-like
Template: RT-PCR
Corresponding TF Gene: GRMZM2G144346
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: R175F 3' Primer Name: R175R
5' Primer Sequence: caccATGACGAACGCCGGGGCG 3' Primer Sequence: AAACCGGAAGCGCCCGTCC
5' Primer Tm (º C): 67.5 3' Primer Tm (º C): 63.6
PCR Condition:
Nucleotide Sequence: ATGACGAACGCCGGGGCGGCGACAGGCGCCGCGCTAGGCGCGCGCACGGCGCGGTCCTGCGATAGCTGCATGCGGCGGAG
GGCGCGCTGGCACTGCCCCGCGGACAACGCGTTCCTGTGCCAGTCCTGCGACGTCTCCGTCCACTCGGCGAACCCGCTCG
CGCGGCGCCACCACCGCGTCCGCCTCCCCTCGGCGTCCTGCTCGTCCCCACCGCGCGATCCCGACGCGCCGACGTGGCTC
CACGGCCTCAAGCGACGGCCGCGCACGCCGCGGTCCAAGCCCGGGGGAAGCAATAAGCATGAGGCGGCGCCCAGCTCTAT
CGCCGCGGCCGCGTCGGCAGCGGTCCCCGACCTCGAGGCGGAGGCGGAGGCGGAGGCGGAGGAGTCCGGCTCCGGTATCC
TGGGCGATAACGACGACGACCACGGGTTCCAGGACGACGACGAGAACCTTCTGTACTGCGTGCCGGTGTTCGATCCTATG
CTCGCCGAGTTCTACAACCCCGTGGCCGACGAGGGGGAGCAGAAGCCGGCCTGCCTGATGCTGCCTCTCGTGGAAACATC
GCCGGAGTTCGCCTCCGGCGGCTTGGCAGAGGCGGACGGGCTCTCCGGCTTCGACGTCCCGGACATGGATCTCGCTAGCT
TCGCGGCGGACATGGAGAGCCTCCTCATGGGAGTCGACGACGGGTTTGACGATCTGGGTTTCTTGGACGAACAGAAGCCT
CAGGTGAACGCGGACGTGGACTTGGAGGCCATGGCGGCGCCGGAGCCTGAACGAGAGGACAAGAAAAGGAAGCGGGACGG
CTTTGATTATCTGGGTTTCTTGGACGAAGAGAAGCCACAGGTGAACGCGGACGTAGACTTGGAGGCCATGGTGGCGCCGG
AGCCTGAACGAGAGGACAAGAAAAGGAAGCGAACAGATATGATACTCAAGCTGAACTACGAGGGCGTCATCGCCTCGTGG
GTTCGTGACGGCGGATCACCGTGGTACCACGGCGAGCGTCCTCACCTCGACGATCCTTACGAGCTATGGTTGGAGTTCCC
GGCAACGGGGAGCCGGGGACTTTTCGGCGGCACCATGACAGCGGTGACCGGCGGCGAGCGTGAGGCACGGGTGTCGCGGT
ACAGGGAGAAGCGGCGGAGGCGGCTGTTCGCCAAGAAGATCCGGTACGAGGTGCGCAAGCTCAACGCCGAGAAACGGCCG
CGGATGAAGGGCCGGTTCGTGAAGCGCACCACGCTCCCGCCGCTGCCGAGGCCGCCACCGCCGTCACAGCAGCAACAGAA
GAAGAAGCAACTGCCACGCTCATTGCCACACGTGGGCATGGTGCTCGCGCCACCTCCAGGAGCGGACGGGCGCTTCCGGT
TT
TFome clones do not contain stop codon at 3'end.
Translation: MTNAGAATGAALGARTARSCDSCMRRRARWHCPADNAFLCQSCDVSVHSANPLARRHHRVRLPSASCSSPPRDPDAPTWL
HGLKRRPRTPRSKPGGSNKHEAAPSSIAAAASAAVPDLEAEAEAEAEESGSGILGDNDDDHGFQDDDENLLYCVPVFDPM
LAEFYNPVADEGEQKPACLMLPLVETSPEFASGGLAEADGLSGFDVPDMDLASFAADMESLLMGVDDGFDDLGFLDEQKP
QVNADVDLEAMAAPEPEREDKKRKRDGFDYLGFLDEEKPQVNADVDLEAMVAPEPEREDKKRKRTDMILKLNYEGVIASW
VRDGGSPWYHGERPHLDDPYELWLEFPATGSRGLFGGTMTAVTGGEREARVSRYREKRRRRLFAKKIRYEVRKLNAEKRP
RMKGRFVKRTTLPPLPRPPPPSQQQQKKKQLPRSLPHVGMVLAPPPGADGRFRF
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map