TFome Information for pUT5889

TFome Name:pUT5889
Genbank Insert ID:KJ727845
Protein Name:ZmbHLH134
Species: Maize
TF Family: bHLH
Template: RT-PCR
Corresponding TF Gene: GRMZM2G086474
Transcript: T02
Vector: pENTR/SD/D-TOPO
Note: c.G554A p.R185H. Not in functional domain.

5' Primer Name: R29-F 3' Primer Name: R29-R
5' Primer Sequence: caccATGACGCTGGAGGCTCTGTGC 3' Primer Sequence: GACGTCCGGCTGCCCTGTC
5' Primer Tm (º C): 65.6 3' Primer Tm (º C): 63.6
PCR Condition:
Nucleotide Sequence: ATGACGCTGGAGGCTCTGTGCCCGACCAGCAGCGACGTCCTCGTCTACGACACCTTCAACGCCGCCGCCGCATGCGCCGC
TGCTTCTGCGGGGACCTTCCTTTTCGGCAATGCACCACCGGTGGAGGTGCCGGCGGCGGCGGCGGCCCAGGCGAACGGGG
AGAACAGCGTGCAGCAGGGGCGGAGGAAGCGGCGGCGACGGCAGAGGAGCACCAAGAACGCCGAGGACGCCGAGAGCCAG
CGGATGACCCACATCGCCGTCGAGCGCAACCGCCGCCGCCAGATGAACGAGTACCTCGCCGCGCTCCGCTCGCTCATGCC
GGACTCCTACGTCCACCGGAGCGATCAGGCGTCCGTGGTCAGTGGCGCAATCGATTTCGTGAAGGAGCTGGAGCAGCAGC
TGCAATCCCTGGAGGCCCAGAAGCTGGCGCTGAAGCGGCAGCTGCAGCAGCAGCAGCAGCGCAGCGTCACGGCCGCGATA
CGCGACGACGCGGCGCAGCCGGCTCGAGGCCGTGATGACATCGGCGCGGGCGCGGGCGGGGACGCCGCGGCGCACAGCGA
GGTGTCGGCGCCGGAGCCAGACCCGCCTCCGTTCGCGCGGTTCTTCCGGTACCCGCAGTACGCGCGGCGGCACGCGGCGG
CGCGGGAGGACGCCGGCGCGGAGGAGACGAGCCGCGCCTCCGCGGTGGCGGACGTGGAGGTGGGCGTGGTGGTGGACGCG
CACGCCAGCCTGCGCGTGATGGCGCCGCGGAGGCCCGGGCAGCTTCTGCGGATGGTGGCCGGGATGCAGGCGCTCGGCCT
CGCCGTGCTGCACCTCAACGTGGCCACCGCCGCGGTCGACGCGACGGCGCTCTACACGCTCAGCCTCAAGGTGGAGGAAG
GGTGCGCCCTGGCGACGGCGGAGGAGATCGCCGCGGCGGTGCACCACGTCCTATGCATCATCGACGCCGAGGCGACGCCG
CAGAGGCTGCTCGCTGCCGGAGCACCAGGGACAGGGCAGCCGGACGTC
TFome clones do not contain stop codon at 3'end.
Translation: MTLEALCPTSSDVLVYDTFNAAAACAAASAGTFLFGNAPPVEVPAAAAAQANGENSVQQGRRKRRRRQRSTKNAEDAESQ
RMTHIAVERNRRRQMNEYLAALRSLMPDSYVHRSDQASVVSGAIDFVKELEQQLQSLEAQKLALKRQLQQQQQRSVTAAI
RDDAAQPARGRDDIGAGAGGDAAAHSEVSAPEPDPPPFARFFRYPQYARRHAAAREDAGAEETSRASAVADVEVGVVVDA
HASLRVMAPRRPGQLLRMVAGMQALGLAVLHLNVATAAVDATALYTLSLKVEEGCALATAEEIAAAVHHVLCIIDAEATP
QRLLAAGAPGTGQPDV
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map