TFome Information for pUT5961

TFome Name:pUT5961
Genbank Insert ID:KJ727869
Protein Name:ZmbZIP97
Species: Maize
TF Family: bZIP
Template: gDNA
Corresponding TF Gene: GRMZM2G122846
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: SE0056_F 3' Primer Name: SE0056_R
5' Primer Sequence: caccATGTACCCTGCTGCAGAGATC 3' Primer Sequence: GCCGGGAGTTTTCACGGAG
5' Primer Tm (º C): 61.2 3' Primer Tm (º C): 58.7
PCR Condition: 5 l GC buffer 5 l 5x CES 1.5l MgCl2 50mM 1 l dNTPs 10mM 1 l DNA template (c=50 ng/l) 1 l primer forward 10mM 1 l primer reverse 10mM 0.25 l phusion taq 9.25 l ultrapure water PCR program: 3min 98°C 35x : 40 sec 98°C 60 sec 72°C 10 min 72°C leave at 10°C
Nucleotide Sequence: ATGTACCCTGCTGCAGAGATCGCTAGCGTCCGATACCTATCTCCTGCTGCAGGCGCAGCCTCTCTCAGACCTCATTACCG
TGACGACTTCCTCTTCCAGTTCCAGTACAGCGACCTCCTGCTGGCGCCTGCGCACCCTTCGCTCTACCAAGATGTCGCTG
ATCACCTGGTCCTCGGAGCTAGCTTCCCGGCTGCTGGTGACAACAGGTCCAGCTCGGAGGAGTCGGACGCCTACCTGCAG
CGCAGCCTCGCGGAGGAGCGCAGGAAGAGGAGGATGGTATCCAACAGGGAGTCCGCCCGGCGGTCGCGCGTGAGGAAGCA
GAAGCAGCTGAGCGAGCTCTGGGCGCAGGTCGTCCACCTCCGCGGCACCAACCGCCAGCTCCTTGACCAGCTCAAGTGCT
CAACCGTGTCATCAGAGACTGCGACCGTATCCTCCGTGAAAACTCCCGGC
TFome clones do not contain stop codon at 3'end.
Translation: MYPAAEIASVRYLSPAAGAASLRPHYRDDFLFQFQYSDLLLAPAHPSLYQDVADHLVLGASFPAAGDNRSSSEESDAYLQ
RSLAEERRKRRMVSNRESARRSRVRKQKQLSELWAQVVHLRGTNRQLLDQLKCSTVSSETATVSSVKTPG
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: Erich Grotewold <grotewold.1@osu.edu>
 
Plasmid Map