TFome Information for pUT6036

TFome Name:pUT6036
Genbank Insert ID:KJ727940
Protein Name:ZmCOL10
Species: Maize
TF Family: C2C2-CO-like
Template: BT063806
Corresponding TF Gene: GRMZM2G012717
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: UT2969up 3' Primer Name: UT2969dn
5' Primer Sequence: caccATGATTGCCACGACCCGC 3' Primer Sequence: AGCGAGGCCAGCGATGG
5' Primer Tm (º C): 56.4 3' Primer Tm (º C): 56.9
PCR Condition:
Nucleotide Sequence: ATGATTGCCACGACCCGCGGCAGCTCGGCGAAGGCGGCGGCGGCGGTGGGCGGCAAGGCGGCGCGCGCCTGTGACGGGTG
CCTGCGGCGGCGGGCGAGGTGGTACTGCGCGGCGGACGACGCGTTCCTGTGCCAAGGGTGCGACACGTCGGTGCACTCGG
CGAACCCGCTCGCGCGGCGGCACGAGCGGCTGCGCCTGTGCCCGGCGTCTCCGCTGCAGACGCCGCCAGATCGCTCGGCG
GCGGCGGCAGCGACGGCGACTAATAAGCGCGAGCGTCACGACGAGGTGGCGGTGCCCGCGTGGTTCGGGCGCAAGGCGCG
AACCCCGCGCGGCGGGCACGCCAAAAGCGTCGGCCAGGTGGCGTTGTCGCGGCGCCTCGTCGTACCGCATGCGGCTGGCG
GGGACTCAGACTCACCCGATGAGCGAAACGGCGGCGAGGAGGAGCAGCTGCTCTACCGCGTGCCCATCCTTGACCCCGCC
CTAGCCGAGTTCTGCTCGCCCCCGCCTCTCGAGGACGCGGCCGGTCTCGCTCTCGACGCGTCGGTGTGCAACGAAGACGG
CGCCATCGAGGACCCCGCGAAGCCGGATCCTGCGGCGCCGCTGGCCCAGTTCTGCCCCGTCAGCGGCCATTTCAACTTCG
GCCCGACCGACGCCGAGCTCAGGGAGTTCGCCGCGGACATGGAAGCCCTCCTCGGGCACGGCCTGGACGACGGAAACGAG
GAGGACTCGTCGTTTTACATGGAGACGCTGGGCCTCCTCGACCCAATGGAAGTGGGCGACGATGCCACGCAAGTCAAGGT
GGAGACCGACGGCAGCAGTGCGTGCTGCGAAGCCAGTGGCACGCTGGCCTGTGGCCTGGAGCTGGACTTAGAGGCATCTG
ACGAGATGCTGGACATCGACTTCGACTACGCATCGCCTCAGGACACGGCGACGGACGAGAGAGCCGCCAGCAGCGACACG
GGAGCCGACGCCCAGTTCTTGCAGACGAGCCTCTCGCTCACCCTCAACTACGAGGCCATCATCCAGAGCTGGGGGAGCTC
GCCGTGGACCGGTGGCGGTGAGCGACCACACGTCAAGCTCGACACCAGGTGGCCCCACGACTACACGAACATGTGGGTTG
TGGGAGGAGTGGTCGGCCACGGCGGCGAGGACCTGCCGGGCACGCCTAGGCTGGGGATGGACGGCGGCCGGGAGGCCCGG
GTGTCGCGGTACCGGGAGAAGCGGAGGACGCGGCTCTTCTCCAAGAAGATACGGTACGAGGTGCGCAAGCTCAACGCCGA
GAAGCGGCCACGGATGAAGGGCCGATTCGTCAAGCGTGCTACCGCCGGTGGCAGCCTCGCCATCGCTGGCCTCGCT
TFome clones do not contain stop codon at 3'end.
Translation: MIATTRGSSAKAAAAVGGKAARACDGCLRRRARWYCAADDAFLCQGCDTSVHSANPLARRHERLRLCPASPLQTPPDRSA
AAAATATNKRERHDEVAVPAWFGRKARTPRGGHAKSVGQVALSRRLVVPHAAGGDSDSPDERNGGEEEQLLYRVPILDPA
LAEFCSPPPLEDAAGLALDASVCNEDGAIEDPAKPDPAAPLAQFCPVSGHFNFGPTDAELREFAADMEALLGHGLDDGNE
EDSSFYMETLGLLDPMEVGDDATQVKVETDGSSACCEASGTLACGLELDLEASDEMLDIDFDYASPQDTATDERAASSDT
GADAQFLQTSLSLTLNYEAIIQSWGSSPWTGGGERPHVKLDTRWPHDYTNMWVVGGVVGHGGEDLPGTPRLGMDGGREAR
VSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRATAGGSLAIAGLA
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map