TFome Information for pUT6040

TFome Name:pUT6040
Genbank Insert ID:KJ727944
Protein Name:ZmbHLH131
Species: Maize
TF Family: bHLH
Template: EC878524
Corresponding TF Gene: GRMZM2G171464
Transcript: T01
Vector: pENTR/SD/D-TOPO

5' Primer Name: 3' Primer Name:
5' Primer Sequence: 3' Primer Sequence:
5' Primer Tm (º C): 3' Primer Tm (º C):
PCR Condition:
Nucleotide Sequence: ATGGAGAGGATGCAACTGCAAGGGCCCATCGCCTCTTCGCTGTGGACGGACAAACAGCAGGTGGTGGCCAGCACCAGCGC
CGCAATGGCGGCGCAGATGCCCTTCCTGGCGTTGCTCCAGGGCGCAGGCGTCGTGGTGGAGGGGGCGGAGACGGAGCAGC
AGCAGTACGAGCACGAGCACGACGGGCGCAAGCGGCAGGCCTTGGCGCGCGCCGTCTCCAAACTCGACCTGCTCGAGAGC
TGTCTCACGCAGGCGGCGGCTCCCGCGGCGGCGGCGTGTGCGCCAGTGGCCAGCAGGACGACCGAGAGGCGGATGAAGCG
GCCGAGGACCCGCGCGCGAGCCGCGCCACCGCCGGAGAAGCGCAGGAAGCCCGAGGAGGCCGAGAGCCAGCGGATGACGC
ACATCGCCGTGGAGCGCAACCGGCGGCGCCTCATGAACGACCACCTGGCCTCGCTCCGCTCACTCATCCCCTCCAGCTAT
ATCCCCCGCGTGAGCCATGCAATGCAAAGCCCATGCATGCATGCTGCGTTCCGTTTCGATCTGACGACGCAACGGTTACA
TGCAATGCAATGCAGGGCGACCAGGCTACGGTGGTGGGCGGTGCGATCGACTACG
TFome clones do not contain stop codon at 3'end.
Translation: MERMQLQGPIASSLWTDKQQVVASTSAAMAAQMPFLALLQGAGVVVEGAETEQQQYEHEHDGRKRQALARAVSKLDLLES
CLTQAAAPAAAACAPVASRTTERRMKRPRTRARAAPPPEKRRKPEEAESQRMTHIAVERNRRRLMNDHLASLRSLIPSSY
IPRVSHAMQSPCMHAAFRFDLTTQRLHAMQCRATRLRWWAVRSTT
Request Information: Deposited to ABRC.
PI responsible for TF ORF clone synthesis: John Gray <jgray5@utnet.utoledo.edu>
 
Plasmid Map